SitesBLAST
Comparing N515DRAFT_0573 N515DRAFT_0573 branched-chain amino acid aminotransferase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1iyeA Crystal structure of eschelichia coli branched-chain amino acid aminotransferase (see paper)
58% identity, 96% coverage: 5:304/313 of query aligns to 4:304/304 of 1iyeA
- active site: F33 (= F34), G35 (= G36), K156 (= K156), A157 (= A157), E190 (= E190), L214 (= L214)
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: R56 (= R57), Y92 (= Y93), Y126 (= Y127), K156 (= K156), Y161 (= Y161), E190 (= E190), G193 (= G193), E194 (= E194), N195 (= N195), L214 (= L214), G216 (= G216), I217 (= I217), T218 (= T218), G253 (= G253), T254 (= T254), A255 (= A255)
1iydA Crystal structure of eschelichia coli branched-chain amino acid aminotransferase (see paper)
58% identity, 96% coverage: 5:304/313 of query aligns to 4:304/304 of 1iydA
- active site: F33 (= F34), G35 (= G36), K156 (= K156), A157 (= A157), E190 (= E190), L214 (= L214)
- binding glutaric acid: Y92 (= Y93), Y126 (= Y127), A255 (= A255)
- binding pyridoxal-5'-phosphate: R56 (= R57), K156 (= K156), Y161 (= Y161), E190 (= E190), G193 (= G193), E194 (= E194), L214 (= L214), G216 (= G216), I217 (= I217), T218 (= T218), T254 (= T254)
1i1mA Crystal structure of escherichia coli branched-chain amino acid aminotransferase. (see paper)
58% identity, 96% coverage: 5:304/313 of query aligns to 4:304/304 of 1i1mA
- active site: K156 (= K156)
- binding 4-methyl valeric acid: Y92 (= Y93), K156 (= K156), T254 (= T254), A255 (= A255)
- binding pyridoxal-5'-phosphate: R56 (= R57), K156 (= K156), Y161 (= Y161), E190 (= E190), G193 (= G193), E194 (= E194), L214 (= L214), G216 (= G216), I217 (= I217), T218 (= T218), G253 (= G253), T254 (= T254)
1i1lA Crystal structure of eschelichia coli branched-chain amino acid aminotransferase. (see paper)
58% identity, 96% coverage: 5:304/313 of query aligns to 4:304/304 of 1i1lA
- active site: K156 (= K156)
- binding 2-methylleucine: Y92 (= Y93), K156 (= K156), T254 (= T254), A255 (= A255)
- binding pyridoxal-5'-phosphate: R56 (= R57), K156 (= K156), Y161 (= Y161), E190 (= E190), G193 (= G193), G216 (= G216), I217 (= I217), T218 (= T218), T254 (= T254)
4whxA X-ray crystal structure of an amino acid aminotransferase from burkholderia pseudomallei bound to the co-factor pyridoxal phosphate
46% identity, 95% coverage: 6:303/313 of query aligns to 9:306/306 of 4whxA
2ej0B Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase with pyridoxamine 5'-phosphate
45% identity, 96% coverage: 5:304/313 of query aligns to 6:305/305 of 2ej0B
- active site: F35 (= F34), G37 (= G36), K158 (= K156), E192 (= E190), L215 (= L214)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R58 (= R57), Y163 (= Y161), E192 (= E190), G195 (= G193), E196 (= E194), L215 (= L214), G217 (= G216), I218 (= I217), T219 (= T218), G254 (= G253), T255 (= T254)
2ej2A Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate
43% identity, 96% coverage: 5:304/313 of query aligns to 6:294/294 of 2ej2A
- active site: F35 (= F34), G37 (= G36), K147 (= K156), E181 (= E190), L204 (= L214)
- binding 4-[(1,3-dicarboxy-propylamino)-methyl]-3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridinium: R58 (= R57), Y94 (= Y93), Y152 (= Y161), E181 (= E190), G184 (= G193), E185 (= E194), L204 (= L214), G206 (= G216), I207 (= I217), T208 (= T218), T244 (= T254), A245 (= A255)
2ej3A Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with gabapentin
43% identity, 96% coverage: 5:304/313 of query aligns to 6:297/297 of 2ej3A
- active site: F35 (= F34), G37 (= G36), K150 (= K156), E184 (= E190), L207 (= L214)
- binding [1-(aminomethyl)cyclohexyl]acetic acid: G187 (= G193), G246 (= G253), T247 (= T254), A248 (= A255)
- binding pyridoxal-5'-phosphate: R58 (= R57), K150 (= K156), Y155 (= Y161), E184 (= E190), G187 (= G193), L207 (= L214), G209 (= G216), I210 (= I217), T211 (= T218), G246 (= G253), T247 (= T254)
2eiyA Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with 4-methylvaleric acid
43% identity, 96% coverage: 5:304/313 of query aligns to 6:297/297 of 2eiyA
- active site: F35 (= F34), G37 (= G36), K150 (= K156), E184 (= E190), L207 (= L214)
- binding 4-methyl valeric acid: F35 (= F34), Y94 (= Y93), T247 (= T254), A248 (= A255)
- binding pyridoxal-5'-phosphate: R58 (= R57), K150 (= K156), Y155 (= Y161), E184 (= E190), G187 (= G193), E188 (= E194), L207 (= L214), G209 (= G216), I210 (= I217), T211 (= T218), G246 (= G253), T247 (= T254)
1wrvA Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase
43% identity, 96% coverage: 5:304/313 of query aligns to 6:297/297 of 1wrvA
- active site: F35 (= F34), G37 (= G36), K150 (= K156), E184 (= E190), L207 (= L214)
- binding pyridoxal-5'-phosphate: R58 (= R57), K150 (= K156), Y155 (= Y161), E184 (= E190), G187 (= G193), L207 (= L214), G209 (= G216), I210 (= I217), T211 (= T218), T247 (= T254)
5e25A Crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans complexed with alpha-ketoglutarate (see paper)
41% identity, 90% coverage: 5:285/313 of query aligns to 4:278/290 of 5e25A
- active site: F33 (= F34), G35 (= G36), K151 (= K156), E184 (= E190), L207 (= L214)
- binding 2-oxoglutaric acid: Y88 (= Y93), K151 (= K156), T247 (= T254), A248 (= A255)
- binding pyridoxal-5'-phosphate: R52 (= R57), K151 (= K156), Y155 (= Y161), E184 (= E190), G187 (= G193), D188 (≠ E194), L207 (= L214), G209 (= G216), I210 (= I217), T211 (= T218), G246 (= G253), T247 (= T254)
6thqB Crystal structure of branched-chain aminotransferase from thermophilic archaea thermoproteus uzoniensis with norvaline
39% identity, 96% coverage: 6:304/313 of query aligns to 9:301/301 of 6thqB
- active site: F37 (= F34), K156 (= K156), E190 (= E190), L214 (= L214)
- binding pyridoxal-5'-phosphate: R60 (= R57), K156 (= K156), Y161 (= Y161), E190 (= E190), N195 (= N195), L214 (= L214), G216 (= G216), I217 (= I217), T218 (= T218), T254 (= T254)
- binding 2-[o-phosphonopyridoxyl]-amino-pentanoic acid: R60 (= R57), Y97 (= Y93), K156 (= K156), Y161 (= Y161), E190 (= E190), G193 (= G193), E194 (= E194), N195 (= N195), G216 (= G216), I217 (= I217), T218 (= T218), G253 (= G253), T254 (= T254), A255 (= A255)
5mr0D Thermophilic archaeal branched-chain amino acid transaminases from geoglobus acetivorans and archaeoglobus fulgidus: biochemical and structural characterisation (see paper)
39% identity, 91% coverage: 5:288/313 of query aligns to 3:280/290 of 5mr0D
- active site: F32 (= F34), G34 (= G36), K150 (= K156), E183 (= E190), L206 (= L214)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: R51 (= R57), G100 (= G106), L101 (≠ V107), K150 (= K156), Y154 (= Y161), E183 (= E190), G186 (= G193), D187 (≠ E194), L206 (= L214), I209 (= I217), T210 (= T218), G245 (= G253), T246 (= T254)
6h65C Crystal structure of the branched-chain-amino-acid aminotransferase from haliangium ochraceum
38% identity, 95% coverage: 7:304/313 of query aligns to 8:307/308 of 6h65C
- active site: F35 (= F34), K158 (= K156), E192 (= E190), L216 (= L214)
- binding pyridoxal-5'-phosphate: R60 (= R57), K158 (= K156), Y163 (= Y161), E192 (= E190), A196 (≠ E194), L216 (= L214), S218 (≠ G216), V219 (≠ I217), T220 (= T218), G256 (= G253), T257 (= T254)
6q8eA Crystal structure of branched-chain amino acid aminotransferase from thermobaculum terrenum in pmp-form (see paper)
39% identity, 96% coverage: 5:303/313 of query aligns to 5:304/307 of 6q8eA
- active site: F34 (= F34), K156 (= K156), E190 (= E190), L214 (= L214)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R59 (= R57), K156 (= K156), Y161 (= Y161), E190 (= E190), G193 (= G193), S194 (≠ E194), C195 (≠ N195), L214 (= L214), S216 (≠ G216), I217 (= I217), T218 (= T218), G254 (= G253), T255 (= T254)
7neaA Crystal structure of branched-chain amino acid aminotransferase from thermobaculum terrenum (m3 mutant). (see paper)
38% identity, 96% coverage: 5:303/313 of query aligns to 5:304/309 of 7neaA
- active site: F34 (= F34), K156 (= K156), E190 (= E190), L214 (= L214)
- binding pyridoxal-5'-phosphate: R59 (= R57), K156 (= K156), Y161 (= Y161), E190 (= E190), G193 (= G193), S194 (≠ E194), L214 (= L214), S216 (≠ G216), I217 (= I217), T218 (= T218), T255 (= T254)
7p3tB Transaminase of gamma-proteobacterium (see paper)
36% identity, 94% coverage: 4:298/313 of query aligns to 4:289/299 of 7p3tB
- binding pyridoxal-5'-phosphate: R53 (= R57), K153 (≠ A155), R157 (≠ Y161), E186 (= E190), S187 (≠ G191), A188 (= A192), A189 (≠ G193), S190 (≠ E194), G210 (= G216), I211 (= I217), T212 (= T218), T248 (= T254)
8ivpB Crystal structure of mv in complex with llp and fru from mycobacterium vanbaalenii
33% identity, 77% coverage: 49:290/313 of query aligns to 70:311/322 of 8ivpB
Sites not aligning to the query:
3ht5A Crystal structure of ilve a branched chain amino acid transaminase from mycobacterium tuberculosis (see paper)
32% identity, 94% coverage: 7:301/313 of query aligns to 17:332/335 of 3ht5A
- active site: K171 (= K156)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R68 (= R57), K171 (= K156), Y176 (= Y161), E207 (= E190), G210 (= G193), M211 (≠ E194), N212 (= N195), L235 (= L214), G237 (= G216), I238 (= I217), T239 (= T218), T281 (= T254)
3uyyB Crystal structures of branched-chain aminotransferase from deinococcus radiodurans complexes with alpha-ketoisocaproate and l-glutamate suggest its radio-resistance for catalysis (see paper)
30% identity, 95% coverage: 7:303/313 of query aligns to 28:337/337 of 3uyyB
- active site: K181 (= K156)
- binding pyridoxal-5'-phosphate: R79 (= R57), R171 (= R145), K181 (= K156), Y186 (= Y161), E217 (≠ S189), G219 (= G191), A220 (= A192), A221 (≠ G193), S244 (≠ G216), I245 (= I217), T246 (= T218), G282 (= G253), T283 (= T254)
Query Sequence
>N515DRAFT_0573 N515DRAFT_0573 branched-chain amino acid aminotransferase
MTTPFLWHNGQIKPWTEATVHVSTHALHYGSSVFEGERVYATPQGPAYFRLADHTRRLFE
SARVYEIEVGYSEDEINAACMEVIRANRMGSAYVRPIVFRGAGGLGVLAKPGAPVDVAIM
AMEWGAYLGDAREQGADVCVSSWQRPAPNTVPSWAKAGGNYLSSQLIGLEARRGGYAEGI
ALGHNGLLSEGAGENVFVVKNGKLLTPPTSAGILAGITRDTVMTLAEDLGIKVEERDLPR
EALYTADEVFMTGTAAEITPVRSVDRKPVGTGRPGPITRALQDAFFGLFDGRTDDRWGWL
APVHVQAAEQVAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory