Comparing N515DRAFT_0575 FitnessBrowser__Dyella79:N515DRAFT_0575 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
1vb3A Crystal structure of threonine synthase from escherichia coli
36% identity, 93% coverage: 21:431/441 of query aligns to 17:425/428 of 1vb3A
8g1yA Crystal structure of the threonine synthase from streptococcus pneumoniae in complex with pyridoxal 5-phosphate.
32% identity, 95% coverage: 5:424/441 of query aligns to 5:485/496 of 8g1yA
4f4fA X-ray crystal structure of plp bound threonine synthase from brucella melitensis
33% identity, 93% coverage: 5:412/441 of query aligns to 2:440/464 of 4f4fA
Q42598 Threonine synthase; TS; EC 4.2.3.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
31% identity, 89% coverage: 1:392/441 of query aligns to 1:459/514 of Q42598
1kl7A Crystal structure of threonine synthase from yeast (see paper)
34% identity, 71% coverage: 6:320/441 of query aligns to 6:341/509 of 1kl7A
Sites not aligning to the query:
2c2bA Crystallographic structure of arabidopsis thaliana threonine synthase complexed with pyridoxal phosphate and s-adenosylmethionine (see paper)
28% identity, 64% coverage: 107:388/441 of query aligns to 124:403/444 of 2c2bA
Sites not aligning to the query:
Q9S7B5 Threonine synthase 1, chloroplastic; Protein METHIONINE OVER-ACCUMULATOR 2; EC 4.2.3.1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
28% identity, 64% coverage: 107:388/441 of query aligns to 199:478/526 of Q9S7B5
Sites not aligning to the query:
2c2gA Crystal structure of threonine synthase from arabidopsis thaliana in complex with its cofactor pyridoxal phosphate (see paper)
27% identity, 64% coverage: 107:388/441 of query aligns to 142:405/448 of 2c2gA
>N515DRAFT_0575 FitnessBrowser__Dyella79:N515DRAFT_0575
MSEPLLYHSTRGAAHGAGIGEAIAAGLAPDGGLYVPEALPSRRPDDFDPDGTLADTAARL
LRPFFAGHALAAELPAICAEAFCFDAPLRPLPQHPGAAMLELFHGPSAAFKDFGARFLAS
CFRRLRKAGEAPLTILVATSGDTGAAVAAAFHRQPGVEVVILYPDGLVSPRQAHQLGCFG
DNVRALRVAGRFDDCQRMVKAALNDTALQAQRPLSSANSISLGRLLPQMAYYAHASLRWW
REHRRPLNFIVPTGNLGNALAAVWVREMGLPVGAIELACNANETLPDYFAGTPYAPRAAV
ATLANAMDVGAPSNFERLRWTFPYDDDLRGQLSSHSVDDDTIRATVRRHALEHGEVFCPH
TATAMHRLDLRQEKADWAVVSTAHAAKFESVVEPLIGRGVAVPPALQAMLARPAQAEAIE
ASDDALKQWLLPQPAHVRRLG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory