Comparing N515DRAFT_0589 FitnessBrowser__Dyella79:N515DRAFT_0589 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
2p50A Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn (see paper)
39% identity, 97% coverage: 7:381/386 of query aligns to 1:376/382 of 2p50A
P0AF18 N-acetylglucosamine-6-phosphate deacetylase; GlcNAc 6-P deacetylase; EC 3.5.1.25 from Escherichia coli (strain K12) (see 2 papers)
39% identity, 97% coverage: 7:381/386 of query aligns to 1:376/382 of P0AF18
2p53A Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d273n mutant complexed with n-acetyl phosphonamidate-d-glucosamine-6- phosphate (see paper)
39% identity, 97% coverage: 7:381/386 of query aligns to 1:376/382 of 2p53A
3iv8A N-acetylglucosamine-6-phosphate deacetylase from vibrio cholerae complexed with fructose 6-phosphate
40% identity, 97% coverage: 7:381/386 of query aligns to 2:374/379 of 3iv8A
O32445 N-acetylglucosamine-6-phosphate deacetylase; GlcNAc 6-P deacetylase; EC 3.5.1.25 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
40% identity, 97% coverage: 7:381/386 of query aligns to 1:373/378 of O32445
1yrrA Crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12 at 2.0 a resolution (see paper)
39% identity, 97% coverage: 7:381/386 of query aligns to 1:375/381 of 1yrrA
2p50B Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn (see paper)
37% identity, 97% coverage: 7:381/386 of query aligns to 1:350/356 of 2p50B
7nutA Crystal structure of human amdhd2 in complex with zn and glcn6p (see paper)
40% identity, 98% coverage: 2:381/386 of query aligns to 2:393/401 of 7nutA
6jkuA Crystal structure of n-acetylglucosamine-6-phosphate deacetylase from pasteurella multocida (see paper)
35% identity, 97% coverage: 7:381/386 of query aligns to 8:380/385 of 6jkuA
1yrrB Crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12 at 2.0 a resolution (see paper)
35% identity, 97% coverage: 9:381/386 of query aligns to 2:328/334 of 1yrrB
O34450 N-acetylglucosamine-6-phosphate deacetylase; GlcNAc 6-P deacetylase; EC 3.5.1.25 from Bacillus subtilis (strain 168) (see paper)
35% identity, 81% coverage: 57:368/386 of query aligns to 54:371/396 of O34450
2vhlB The three-dimensional structure of the n-acetylglucosamine-6- phosphate deacetylase from bacillus subtilis (see paper)
35% identity, 81% coverage: 57:368/386 of query aligns to 53:370/393 of 2vhlB
1o12A Crystal structure of n-acetylglucosamine-6-phosphate deacetylase (tm0814) from thermotoga maritima at 2.5 a resolution
30% identity, 84% coverage: 57:381/386 of query aligns to 40:357/363 of 1o12A
6fv4A The structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d267a mutant from mycobacterium smegmatis in complex with n-acetyl-d- glucosamine-6-phosphate (see paper)
37% identity, 76% coverage: 52:345/386 of query aligns to 45:342/381 of 6fv4A
6fv4B The structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d267a mutant from mycobacterium smegmatis in complex with n-acetyl-d- glucosamine-6-phosphate (see paper)
37% identity, 76% coverage: 52:345/386 of query aligns to 45:342/385 of 6fv4B
6fv3D Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase from mycobacterium smegmatis. (see paper)
39% identity, 60% coverage: 52:284/386 of query aligns to 43:274/350 of 6fv3D
>N515DRAFT_0589 FitnessBrowser__Dyella79:N515DRAFT_0589
MSAAQPLLALVNGRVLADHGPRNDLAVLVRGGRIEALVPAGDPSLDKATRHDLQGRLLLP
GFIDVQVNGGGGLLFNAAPTVDTLRGIAAAHRRFGTTGMLPTLITDTADVMHAALEAVDA
AIAEGVPGILGIHLEGPFLAPARKGIHDANLFRLPDAADIADIARKHRGVVMMTLAPERV
PLETIRQLSAAGVIVVAGHTAADYATMRAALDAGVSGFTHLYNAMTPLGSRDPGVVGAAL
DDPHSWCGLIVDLHHVHPASLRVAIAAKARGKSVLVTDAMPPVGADDPTYVLNGQTIVAR
DGVCQSDDGVLAGSALDMATGVRHLVNAVGLPLAEASRMASAYPAAWLGLERELGRIVAG
QRADFAVLDDALVVQETWIGGVRYAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory