SitesBLAST
Comparing N515DRAFT_0590 FitnessBrowser__Dyella79:N515DRAFT_0590 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8fdbB Crystal structure of nagb-ii phosphosugar isomerase from shewanella denitrificans os217 in complex with glucitolamine-6-phosphate at 3.06 a resolution. (see paper)
43% identity, 99% coverage: 5:344/344 of query aligns to 3:333/333 of 8fdbB
- binding 2-deoxy-2-amino glucitol-6-phosphate: R49 (= R51), R49 (= R51), G50 (= G52), S51 (= S53), S52 (= S54), Y61 (= Y63), A75 (≠ S77), P76 (= P78), S77 (= S79), S97 (= S99), Q98 (= Q100), S99 (= S101), R211 (= R213), Y215 (≠ F217), K224 (= K226), E227 (= E229), S237 (= S239)
8fdbA Crystal structure of nagb-ii phosphosugar isomerase from shewanella denitrificans os217 in complex with glucitolamine-6-phosphate at 3.06 a resolution. (see paper)
43% identity, 99% coverage: 5:344/344 of query aligns to 2:332/332 of 8fdbA
- binding 2-deoxy-2-amino glucitol-6-phosphate: R48 (= R51), R48 (= R51), G49 (= G52), S50 (= S53), S51 (= S54), D52 (= D55), Y60 (= Y63), A74 (≠ S77), P75 (= P78), S76 (= S79), S96 (= S99), Q97 (= Q100), S98 (= S101), V147 (= V150), A148 (= A151), A149 (= A152), R210 (= R213), Y214 (≠ F217), K223 (= K226), E226 (= E229), S236 (= S239)
- binding magnesium ion: G47 (≠ A50), R48 (= R51), Y60 (= Y63), I95 (= I98), S96 (= S99), R210 (= R213), Y214 (≠ F217)
8eymA Crystal structure of nagb-ii phosphosugar isomerase from shewanella denitrificans os217 in complex with glucitolamine-6-phosphate and n- acetylglucosamine-6-phosphate at 2.31 a resolution (see paper)
43% identity, 95% coverage: 5:332/344 of query aligns to 1:319/319 of 8eymA
- binding 2-acetamido-2-deoxy-6-O-phosphono-alpha-D-glucopyranose: R47 (= R51), D51 (= D55), Y59 (= Y63), A71 (≠ S75), A72 (= A76), P74 (= P78), S75 (= S79), R209 (= R213), S235 (= S239), E238 (= E242)
- binding 2-deoxy-2-amino glucitol-6-phosphate: G48 (= G52), S49 (= S53), S95 (= S99), Q96 (= Q100), A147 (= A151), A148 (= A152), K222 (= K226), E225 (= E229)
1morA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucose 6-phosphate (see paper)
30% identity, 97% coverage: 6:339/344 of query aligns to 23:361/366 of 1morA
- active site: E239 (= E222), K243 (= K226), E246 (= E229), H262 (= H245), K361 (= K339)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (≠ S53), S105 (= S99), Q106 (= Q100), S107 (= S101), T110 (≠ S104), V157 (= V150), A360 (≠ R338), K361 (= K339)
1moqA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucosamine 6-phosphate (see paper)
30% identity, 97% coverage: 6:339/344 of query aligns to 23:361/366 of 1moqA
- active site: E239 (= E222), K243 (= K226), E246 (= E229), H262 (= H245), K361 (= K339)
- binding 2-amino-2-deoxy-6-O-phosphono-alpha-D-glucopyranose: T60 (≠ S53), S61 (= S54), S105 (= S99), Q106 (= Q100), S107 (= S101), T110 (≠ S104), V157 (= V150), A360 (≠ R338), K361 (= K339)
1mosA Isomerase domain of glucosamine 6-phosphate synthase complexed with 2- amino-2-deoxyglucitol 6-phosphate (see paper)
30% identity, 97% coverage: 6:339/344 of query aligns to 24:362/367 of 1mosA
- active site: E240 (= E222), K244 (= K226), E247 (= E229), H263 (= H245), K362 (= K339)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T61 (≠ S53), S62 (= S54), S106 (= S99), Q107 (= Q100), S108 (= S101), T111 (≠ S104), K244 (= K226), E247 (= E229)
4amvA E.Coli glucosamine-6p synthase in complex with fructose-6p (see paper)
29% identity, 97% coverage: 5:339/344 of query aligns to 264:603/608 of 4amvA
- active site: E481 (= E222), K485 (= K226), E488 (= E229), H504 (= H245), K603 (= K339)
- binding fructose -6-phosphate: G301 (= G52), T302 (≠ S53), S303 (= S54), S347 (= S99), Q348 (= Q100), S349 (= S101), T352 (≠ S104), S401 (≠ A152), K485 (= K226), E488 (= E229)
Sites not aligning to the query:
1jxaA Glucosamine 6-phosphate synthase with glucose 6-phosphate (see paper)
29% identity, 97% coverage: 5:339/344 of query aligns to 264:603/608 of 1jxaA
- active site: E481 (= E222), K485 (= K226), E488 (= E229), H504 (= H245), K603 (= K339)
- binding glucose-6-phosphate: T302 (≠ S53), S303 (= S54), S347 (= S99), Q348 (= Q100), S349 (= S101), T352 (≠ S104), S401 (≠ A152), K485 (= K226), E488 (= E229)
Sites not aligning to the query:
2j6hA E. Coli glucosamine-6-p synthase in complex with glucose-6p and 5-oxo- l-norleucine (see paper)
29% identity, 97% coverage: 5:339/344 of query aligns to 264:603/608 of 2j6hA
- active site: E481 (= E222), K485 (= K226), E488 (= E229), H504 (= H245), K603 (= K339)
- binding glucose-6-phosphate: T302 (≠ S53), S347 (= S99), Q348 (= Q100), S349 (= S101), T352 (≠ S104), V399 (= V150), S401 (≠ A152), E488 (= E229)
Sites not aligning to the query:
- active site: 1, 26, 27, 74, 98, 99, 248
- binding 5-oxo-l-norleucine: 1, 73, 74, 76, 86, 98, 99, 123
7dnrA Crystal structure of zn-bound sis domain of glucosamine-6-p synthase from e. Coli
29% identity, 96% coverage: 6:334/344 of query aligns to 23:356/357 of 7dnrA
2zj4A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
26% identity, 99% coverage: 1:339/344 of query aligns to 1:360/365 of 2zj4A
- active site: E238 (= E222), K242 (= K226), E245 (= E229), H261 (= H245), K360 (= K339)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T60 (≠ S53), S61 (= S54), S105 (= S99), Q106 (= Q100), S107 (= S101), T110 (≠ S104), V156 (= V150), A157 (= A151), K242 (= K226), E245 (= E229)
2zj3A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
26% identity, 99% coverage: 1:339/344 of query aligns to 1:360/365 of 2zj3A
- active site: E238 (= E222), K242 (= K226), E245 (= E229), H261 (= H245), K360 (= K339)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (≠ S53), S61 (= S54), S105 (= S99), Q106 (= Q100), S107 (= S101), T110 (≠ S104), V156 (= V150), A359 (≠ R338), K360 (= K339)
6svmA Crystal structure of human gfat-1 in complex with glucose-6-phosphate, l-glu, and udp-galnac (see paper)
26% identity, 99% coverage: 1:339/344 of query aligns to 296:655/660 of 6svmA
- active site: E533 (= E222), K537 (= K226), E540 (= E229), H556 (= H245), K655 (= K339)
- binding glucose-6-phosphate: C353 (≠ R51), T355 (≠ S53), S356 (= S54), S400 (= S99), Q401 (= Q100), S402 (= S101), T405 (≠ S104), S453 (≠ A152), K537 (= K226), E540 (= E229)
- binding magnesium ion: S434 (≠ A133), R435 (≠ A134), T437 (≠ A136)
- binding uridine-diphosphate-n-acetylgalactosamine: R322 (≠ N27), G334 (≠ A33), G424 (≠ A123), T426 (≠ V125), S434 (≠ A133), T437 (≠ A136), C439 (≠ T138), G440 (≠ V139), V441 (≠ I140), H442 (≠ P141)
Sites not aligning to the query:
- active site: 7, 32, 95, 122, 123
- binding glutamic acid: 1, 94, 95, 97, 107, 123, 147
- binding uridine-diphosphate-n-acetylgalactosamine: 289
6r4eA Crystal structure of human gfat-1 in complex with glucose-6-phosphate and l-glu (see paper)
26% identity, 99% coverage: 1:339/344 of query aligns to 299:658/663 of 6r4eA
- active site: E536 (= E222), K540 (= K226), E543 (= E229), H559 (= H245), K658 (= K339)
- binding glucose-6-phosphate: T358 (≠ S53), S359 (= S54), S403 (= S99), Q404 (= Q100), S405 (= S101), T408 (≠ S104), S456 (≠ A152), K540 (= K226), E543 (= E229)
Sites not aligning to the query:
Q06210 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1; D-fructose-6-phosphate amidotransferase 1; Glutamine:fructose-6-phosphate amidotransferase 1; GFAT 1; GFAT1; Hexosephosphate aminotransferase 1; EC 2.6.1.16 from Homo sapiens (Human) (see paper)
26% identity, 99% coverage: 1:339/344 of query aligns to 335:694/699 of Q06210
6r4gA Crystal structure of human gfat-1 in complex with udp-glcnac (see paper)
26% identity, 98% coverage: 1:337/344 of query aligns to 295:652/652 of 6r4gA
- active site: E532 (= E222), K536 (= K226), E539 (= E229), H555 (= H245)
- binding glucose-6-phosphate: G353 (= G52), T354 (≠ S53), S355 (= S54), S399 (= S99), Q400 (= Q100), S401 (= S101), T404 (≠ S104), S452 (≠ A152), E539 (= E229)
- binding magnesium ion: S433 (≠ A133), R434 (≠ A134), T436 (≠ A136)
- binding uridine-diphosphate-n-acetylglucosamine: R321 (≠ N27), G333 (≠ A33), G423 (≠ A123), T425 (≠ V125), S433 (≠ A133), T436 (≠ A136), C438 (≠ T138), G439 (≠ V139), V440 (≠ I140), H441 (≠ P141)
Sites not aligning to the query:
2v4mA The isomerase domain of human glutamine-fructose-6-phosphate transaminase 1 (gfpt1) in complex with fructose 6-phosphate
27% identity, 84% coverage: 44:332/344 of query aligns to 50:352/352 of 2v4mA
- active site: E237 (= E222), K241 (= K226), E244 (= E229), H260 (= H245)
- binding fructose -6-phosphate: T59 (≠ S53), S60 (= S54), S104 (= S99), Q105 (= Q100), S106 (= S101), T109 (≠ S104), A156 (= A151), S157 (≠ A152), K241 (= K226), E244 (= E229)
2pocB The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
28% identity, 82% coverage: 50:332/344 of query aligns to 54:352/352 of 2pocB
- active site: E236 (= E222), K240 (= K226), E243 (= E229), H259 (= H245)
- binding 6-O-phosphono-beta-D-glucopyranose: C55 (≠ R51), T57 (≠ S53), S58 (= S54), S102 (= S99), Q103 (= Q100), S104 (= S101), T107 (≠ S104), E243 (= E229)
- binding uridine-diphosphate-n-acetylglucosamine: G126 (≠ A123), V128 (= V125), S136 (≠ A133), T139 (≠ A136), C141 (≠ T138), G142 (≠ V139), V143 (≠ I140), H144 (≠ P141)
Sites not aligning to the query:
P14742 Glutamine--fructose-6-phosphate aminotransferase [isomerizing]; GFAT; D-fructose-6-phosphate amidotransferase; Hexosephosphate aminotransferase; EC 2.6.1.16 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
26% identity, 99% coverage: 1:339/344 of query aligns to 348:712/717 of P14742
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 active site, For GATase activity
2putA The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
27% identity, 82% coverage: 50:332/344 of query aligns to 54:339/339 of 2putA
- active site: E236 (= E222), K240 (= K226), E243 (= E229)
- binding fructose -6-phosphate: C55 (≠ R51), T57 (≠ S53), S102 (= S99), Q103 (= Q100), S104 (= S101), T107 (≠ S104), A154 (= A151), S155 (≠ A152), K240 (= K226)
- binding uridine-diphosphate-n-acetylglucosamine: G126 (≠ A123), V128 (= V125), S136 (≠ A133), T139 (≠ A136), C141 (≠ T138), G142 (≠ V139), V143 (≠ I140), H144 (≠ P141)
Sites not aligning to the query:
Query Sequence
>N515DRAFT_0590 FitnessBrowser__Dyella79:N515DRAFT_0590
MKQASDTLMYREAHESADVVERQLAANADVLKALGERLRAEPPRFIVTCARGSSDHAAAY
AKYVFETRLGLLTASASPSVASIYDADLKLDGALFLVISQSGKSPDLLRSAQAAKDAGAL
VVAMVNVEDSPLAALADTVIPLRAGPELSVAATKSYLATLAAILQLTAHWGNDDTLHADV
ARLPADLRRGWDADWSALVDGLREARNLFVVGRGYGFGAALEAALKLKETCGLHAEAFSA
AEVKHGPMAIVGAGFPVLFFAQGDDTLDSTLAVAEEFRARGARVLVAKPGASGADALPLP
AGMDSIVTPLLAVQSFYRATSELALARGFDPDVPPHLRKVTETV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory