Comparing N515DRAFT_0640 FitnessBrowser__Dyella79:N515DRAFT_0640 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
3vayA Crystal structure of 2-haloacid dehalogenase from pseudomonas syringae pv. Tomato dc3000 (see paper)
32% identity, 87% coverage: 7:208/233 of query aligns to 2:206/230 of 3vayA
4ygrA Crystal structure of had phosphatase from thermococcus onnurineus (see paper)
35% identity, 43% coverage: 104:203/233 of query aligns to 83:187/215 of 4ygrA
Sites not aligning to the query:
6q7oA Crystal structure of oe1 (see paper)
28% identity, 47% coverage: 95:204/233 of query aligns to 87:202/230 of 6q7oA
Sites not aligning to the query:
6q7nA Crystal structure of bh32 alkylated with the mechanistic inhibitor 2- bromoacetophenone (see paper)
28% identity, 47% coverage: 95:204/233 of query aligns to 87:202/230 of 6q7nA
Sites not aligning to the query:
8bp1A Crystal structure of bhmehis1.0, an engineered enzyme for the morita- baylis-hillman reaction (see paper)
29% identity, 50% coverage: 95:211/233 of query aligns to 87:212/231 of 8bp1A
Sites not aligning to the query:
Q51645 (S)-2-haloacid dehalogenase 4A; 2-haloalkanoic acid dehalogenase IVA; Halocarboxylic acid halidohydrolase IVA; L-2-haloacid dehalogenase IVA; EC 3.8.1.2 from Burkholderia cepacia (Pseudomonas cepacia) (see 2 papers)
31% identity, 55% coverage: 95:221/233 of query aligns to 84:207/231 of Q51645
Sites not aligning to the query:
2no5B Crystal structure analysis of a dehalogenase with intermediate complex (see paper)
31% identity, 55% coverage: 95:221/233 of query aligns to 84:207/226 of 2no5B
Sites not aligning to the query:
Q53464 (S)-2-haloacid dehalogenase; 2-haloalkanoic acid dehalogenase; Halocarboxylic acid halidohydrolase; L-2-haloacid dehalogenase; L-DEX; EC 3.8.1.2 from Pseudomonas sp. (strain YL) (see 2 papers)
28% identity, 97% coverage: 7:232/233 of query aligns to 4:224/232 of Q53464
1zrmA Crystal structure of the reaction intermediate of l-2-haloacid dehalogenase with 2-chloro-n-butyrate (see paper)
29% identity, 95% coverage: 7:228/233 of query aligns to 2:218/220 of 1zrmA
4knvA The crystal structure of apo human hdhd4 from se-mad (see paper)
30% identity, 34% coverage: 128:207/233 of query aligns to 125:210/241 of 4knvA
Sites not aligning to the query:
3qnmA Haloalkane dehalogenase family member from bacteroides thetaiotaomicron of unknown function
24% identity, 97% coverage: 5:231/233 of query aligns to 1:231/231 of 3qnmA
2fdrA Crystal structure of conserved haloacid dehalogenase-like protein of unknown function atu0790 from agrobacterium tumefaciens str. C58
34% identity, 41% coverage: 115:210/233 of query aligns to 93:193/222 of 2fdrA
Sites not aligning to the query:
3umbA Crystal structure of the l-2-haloacid dehalogenase rsc1362
28% identity, 53% coverage: 109:232/233 of query aligns to 100:227/227 of 3umbA
Sites not aligning to the query:
Q9HZ62 N-acetylmuramic acid 6-phosphate phosphatase; MurNAc 6-phosphate phosphatase; MurNAc-6P phosphatase; EC 3.1.3.105 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
25% identity, 85% coverage: 3:201/233 of query aligns to 2:189/226 of Q9HZ62
>N515DRAFT_0640 FitnessBrowser__Dyella79:N515DRAFT_0640
LTRKLRIRALTLDLDDTLWPVLPALERADQELDAYLRQHYPDVARAWPIPAMRALRAQVA
GERLDLAHDFTAQRHITMQRAFAACGLAEAPLDVLWDIYFTARNSVELYADSLPALQRIT
AVFPVASLTNGNADLDMIGIRAHFAHHICARDTGVAKPDPRIFSMAAERLGIAPGEILHV
GDDPVLDVAGAREAGLRTAWINRERVAWPEALGAAPELDLADMTALADWLEAQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory