SitesBLAST
Comparing N515DRAFT_0703 FitnessBrowser__Dyella79:N515DRAFT_0703 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
Q47945 Alcohol dehydrogenase (quinone), cytochrome c subunit; ADH; Alcohol dehydrogenase (quinone), subunit II; Cytochrome c-553; Cytochrome c553; Ethanol:Q2 reductase; G3-ADH subunit II; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 from Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) (see paper)
40% identity, 89% coverage: 45:426/429 of query aligns to 40:436/478 of Q47945
Sites not aligning to the query:
- 1:36 signal peptide
- 37 modified: Pyrrolidone carboxylic acid
8gy2B Cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans
40% identity, 89% coverage: 45:426/429 of query aligns to 2:398/433 of 8gy2B
- binding heme c: C18 (= C61), C21 (= C64), H22 (= H65), T46 (≠ P89), I48 (≠ L91), Y59 (≠ W102), L68 (= L111), R73 (≠ D116), V79 (≠ L122), Y80 (= Y123), M83 (≠ F126), F88 (≠ Y131), R126 (= R168), H165 (= H206), C166 (= C207), C169 (= C210), H170 (= H211), I201 (≠ Y237), A202 (= A238), P203 (= P239), L205 (= L241), W216 (= W252), F224 (≠ L260), A234 (= A270), V235 (≠ A271), F236 (= F272), F236 (= F272), M239 (= M275), N301 (≠ R330), C302 (= C331), C305 (= C334), H306 (= H335), M316 (≠ V345), F317 (≠ Y346), P318 (= P347), L320 (= L349), P324 (≠ S353), G342 (= G371), S352 (≠ R381), V354 (≠ Y383), M356 (= M385), F359 (= F388), M375 (≠ I404)
- binding ubiquinone-10: C21 (= C64), L34 (≠ R77), P39 (= P82), P81 (= P124), L129 (= L171), W132 (= W174), E168 (= E209), R173 (= R214), I197 (≠ V233), D241 (≠ E277)
Sites not aligning to the query:
7w2jC Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
35% identity, 88% coverage: 49:424/429 of query aligns to 1:386/418 of 7w2jC
- binding heme c: C13 (= C61), C16 (= C64), H17 (= H65), T42 (≠ P89), I44 (≠ L91), Y55 (≠ W102), L75 (= L122), Y76 (= Y123), A78 (= A125), M79 (≠ F126), R122 (= R168), H161 (= H206), C162 (= C207), C165 (= C210), H166 (= H211), A191 (= A238), P192 (= P239), R223 (≠ A270), P227 (= P274), M228 (= M275), V289 (≠ R330), C290 (= C331), C293 (= C334), H294 (= H335), Y305 (≠ V345), Y306 (= Y346), P307 (= P347), L309 (= L349), N312 (= N352), T313 (≠ S353), T314 (≠ S354), D322 (≠ N362), I327 (≠ V367), V331 (≠ A373), R333 (≠ S375), I340 (≠ Y383), M342 (= M385), P343 (= P386), F345 (= F388)
8jejC Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
34% identity, 88% coverage: 49:424/429 of query aligns to 1:400/413 of 8jejC
- binding heme c: C13 (= C61), C16 (= C64), H17 (= H65), T42 (≠ P89), I44 (≠ L91), F60 (= F107), L64 (= L111), L75 (= L122), Y76 (= Y123), M79 (≠ F126), P80 (= P127), Y84 (= Y131), R122 (= R168), C162 (= C207), C165 (= C210), H166 (= H211), I186 (= I231), W189 (= W236), A191 (= A238), P192 (= P239), I194 (≠ L241), W205 (= W252), Y213 (≠ L260), R223 (≠ A270), M228 (= M275), V303 (≠ R330), C304 (= C331), C307 (= C334), H308 (= H335), Y320 (= Y346), P321 (= P347), L323 (= L349), T327 (≠ S353), T328 (≠ S354), D336 (≠ N362), I341 (≠ V367), V345 (≠ A373), R347 (≠ S375), I354 (≠ Y383), M356 (= M385), F359 (= F388), I376 (≠ V400)
- binding ubiquinone-10: M36 (≠ F83), P77 (= P124), S124 (≠ T170), W128 (= W174), C165 (= C210), L173 (≠ G218)
Sites not aligning to the query:
8gy3A Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
34% identity, 84% coverage: 49:407/429 of query aligns to 41:410/440 of 8gy3A
- binding heme c: Y52 (≠ D60), C53 (= C61), C56 (= C64), H57 (= H65), S84 (≠ P89), I86 (≠ L91), W97 (= W102), F102 (= F107), L117 (= L122), F121 (= F126), F126 (≠ Y131), R163 (= R168), C203 (= C207), C206 (= C210), H207 (= H211), A232 (= A238), P233 (= P239), L235 (= L241), W245 (= W252), Y253 (≠ L260), L254 (= L261), G263 (= G269), S264 (≠ A270), M269 (= M275), Y292 (≠ L298), C337 (= C331), C340 (= C334), H341 (= H335), P353 (= P347), L355 (= L349), N358 (= N352), N359 (≠ S353), V372 (= V366), I377 (≠ G371), G382 (≠ T376), Q383 (= Q377), I386 (≠ Y383), M388 (= M385), F391 (= F388)
- binding ubiquinone-10: E55 (≠ S63), T76 (= T81), F78 (= F83), Y118 (= Y123), P119 (= P124), I160 (≠ Y165), G166 (≠ L171), Q167 (≠ K172), F169 (vs. gap), W170 (= W174), H202 (= H206), R210 (= R214), L213 (≠ F217)
8hddB Complex structure of catalytic, small, and a partial electron transfer subunits from burkholderia cepacia fad glucose dehydrogenase
37% identity, 24% coverage: 324:424/429 of query aligns to 23:121/121 of 8hddB
- binding protoporphyrin ix containing fe: C30 (= C331), C33 (= C334), H34 (= H335), Y46 (= Y346), P47 (= P347), T54 (≠ S354), V66 (= V366), I67 (≠ V367), R73 (≠ T376), I80 (≠ Y383), M82 (= M385), P83 (= P386)
2zooA Crystal structure of nitrite reductase from pseudoalteromonas haloplanktis tac125
33% identity, 24% coverage: 323:424/429 of query aligns to 339:438/438 of 2zooA
- binding protoporphyrin ix containing fe: C347 (= C331), C350 (= C334), H351 (= H335), F362 (≠ Y346), P363 (= P347), P364 (= P348), L365 (= L349), S368 (≠ N352), Y370 (≠ S354), I382 (= I364), L386 (≠ F372), S387 (≠ A373), G388 (≠ P374), I390 (≠ T376), V392 (≠ G378), Y397 (= Y383), N398 (≠ S384), G399 (≠ M385), V400 (≠ P386), M401 (≠ P387)
Sites not aligning to the query:
- active site: 81, 84, 86, 121, 122, 130, 135, 227, 249, 250, 276
- binding copper (ii) ion: 81, 86, 121, 122, 130, 135
1dt1A Thermus thermophilus cytochrome c552 synthesized by escherichia coli (see paper)
38% identity, 21% coverage: 323:410/429 of query aligns to 2:91/129 of 1dt1A
- binding heme c: C9 (= C331), C12 (= C334), H13 (= H335), P25 (= P347), H30 (≠ N352), Y43 (≠ A363), V47 (= V367), Q53 (≠ A373), G54 (≠ P374), G65 (vs. gap), M67 (= M385), F70 (= F388)
Sites not aligning to the query:
1r0qA Characterization of the conversion of the malformed, recombinant cytochrome rc552 to a 2-formyl-4-vinyl (spirographis) heme (see paper)
38% identity, 21% coverage: 323:410/429 of query aligns to 3:92/130 of 1r0qA
- binding 2-formyl-protoporphryn ix: C13 (= C334), H14 (= H335), P26 (= P347), L28 (= L349), H31 (≠ N352), Y44 (≠ A363), V48 (= V367), Q54 (≠ A373), G55 (≠ P374), G66 (vs. gap), M68 (= M385)
Sites not aligning to the query:
1qyzA Characterization of the malformed, recombinant cytochrome rc552 (see paper)
38% identity, 21% coverage: 323:410/429 of query aligns to 3:92/130 of 1qyzA
- binding 2-acetyl-protoporphyrin ix: Y7 (= Y327), C10 (= C331), C13 (= C334), H14 (= H335), P26 (= P347), H31 (≠ N352), Y44 (≠ A363), Q54 (≠ A373), G55 (≠ P374), G66 (vs. gap), M68 (= M385), F71 (= F388)
Sites not aligning to the query:
1c52A Thermus thermophilus cytochrome-c552: a new highly thermostable cytochromE-C structure obtained by mad phasing (see paper)
38% identity, 21% coverage: 323:410/429 of query aligns to 4:93/131 of 1c52A
- binding protoporphyrin ix containing fe: C11 (= C331), C14 (= C334), H15 (= H335), F26 (≠ Y346), P27 (= P347), L29 (= L349), H32 (≠ N352), Y45 (≠ A363), L54 (≠ F372), Q55 (≠ A373), G56 (≠ P374), G67 (vs. gap), M69 (= M385), F72 (= F388)
Sites not aligning to the query:
6fjaA Crystal structure of t2d three-domain heme-cu nitrite reductase from ralstonia pickettii
32% identity, 27% coverage: 314:427/429 of query aligns to 343:455/455 of 6fjaA
- binding protoporphyrin ix containing fe: T359 (≠ R330), C360 (= C331), C363 (= C334), H364 (= H335), P376 (= P347), P377 (= P348), L378 (= L349), F383 (vs. gap), N400 (≠ A373), G401 (≠ P374), Y410 (= Y383), S412 (vs. gap), M414 (= M385), M417 (≠ F388)
Sites not aligning to the query:
- active site: 90, 93, 95, 130, 131, 139, 144, 236, 258, 259, 285
- binding copper (ii) ion: 90, 131, 139, 144
5oboA Crystal structure of nitrite bound d97n mutant of three-domain heme-cu nitrite reductase from ralstonia pickettii
32% identity, 27% coverage: 314:427/429 of query aligns to 344:456/456 of 5oboA
- binding heme c: T360 (≠ R330), C361 (= C331), C364 (= C334), H365 (= H335), P377 (= P347), P378 (= P348), L379 (= L349), S382 (≠ N352), F384 (vs. gap), I395 (≠ V367), N401 (≠ A373), G402 (≠ P374), S413 (vs. gap), M415 (= M385), M418 (≠ F388)
Sites not aligning to the query:
- active site: 91, 94, 96, 131, 132, 140, 145, 237, 259, 260, 286
- binding copper (ii) ion: 91, 96, 131, 132, 140, 145
- binding nitrite ion: 94, 96, 131
4ax3D Structure of three-domain heme-cu nitrite reductase from ralstonia pickettii at 1.6 a resolution (see paper)
32% identity, 26% coverage: 314:424/429 of query aligns to 346:455/457 of 4ax3D
- binding heme c: C363 (= C331), C366 (= C334), H367 (= H335), P379 (= P347), P380 (= P348), L381 (= L349), S384 (≠ N352), F386 (vs. gap), N403 (≠ A373), G404 (≠ P374), S415 (vs. gap), M417 (= M385), M420 (≠ F388)
Sites not aligning to the query:
- active site: 93, 96, 98, 133, 134, 142, 147, 239, 261, 262, 288
- binding copper (ii) ion: 93, 98, 133, 134, 142, 147
Query Sequence
>N515DRAFT_0703 FitnessBrowser__Dyella79:N515DRAFT_0703
MKIFRIGIAVVVLLGLGLAGWLFLRGGQPSVPRSASRVDAAALKDPALIAKGEYLTLVGD
CASCHTGQGGARFAGGRVVGTPFGDIPAPNLTPDRETGLGEWSFEAFRQALHSGVDRHGQ
FLYPAFPYTSYTKVSRDDALAIFAYLQSLPPLKQAAKQPGLGFPYNVRNTLKAWRALYFR
EGEYVADSTKSPEWNRGAYLVQGLGHCNECHVERDSFGGMRSDQSLSGGQIPVQNWYAPD
LSTQANGGLAGWSERDIADLLKTGQSAKGAAFGPMAEVVARSTQHLNDADLHAIATYLQS
LPARPRVSYEPSLLDTKPMLDQGAKVYAERCADCHGRDGQGVAGVYPPLSGNSSVNEPTG
INAIRVVLLGGFAPSTQGNPRPYSMPPFAQQLNDADVAAVVTYIRQSWGNQAPLVQERDV
IKYRHTPID
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory