Comparing N515DRAFT_0745 FitnessBrowser__Dyella79:N515DRAFT_0745 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
59% identity, 96% coverage: 16:376/377 of query aligns to 17:375/377 of 7t1qA
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
56% identity, 99% coverage: 5:376/377 of query aligns to 6:375/376 of 4o23A
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
56% identity, 99% coverage: 5:376/377 of query aligns to 6:375/375 of 4pqaA
7lgpB Dape enzyme from shigella flexneri
55% identity, 99% coverage: 4:377/377 of query aligns to 7:377/377 of 7lgpB
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
51% identity, 99% coverage: 4:376/377 of query aligns to 9:379/380 of 5vo3A
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
51% identity, 99% coverage: 4:376/377 of query aligns to 5:375/377 of P44514
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
55% identity, 47% coverage: 2:180/377 of query aligns to 3:180/265 of 4op4B
Sites not aligning to the query:
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
52% identity, 47% coverage: 4:180/377 of query aligns to 7:182/258 of 4h2kA
Sites not aligning to the query:
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
27% identity, 94% coverage: 11:363/377 of query aligns to 28:408/426 of 3pfoA
7uoiA Crystallographic structure of dape from enterococcus faecium
30% identity, 56% coverage: 7:218/377 of query aligns to 13:218/383 of 7uoiA
7rsfA Acetylornithine deacetylase from escherichia coli
28% identity, 60% coverage: 21:246/377 of query aligns to 29:250/380 of 7rsfA
2pokA Crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae
29% identity, 51% coverage: 5:197/377 of query aligns to 24:222/458 of 2pokA
Sites not aligning to the query:
Q8C165 N-fatty-acyl-amino acid synthase/hydrolase PM20D1; Peptidase M20 domain-containing protein 1; PM20D1; EC 3.5.1.114; EC 3.5.1.14 from Mus musculus (Mouse) (see paper)
30% identity, 43% coverage: 39:200/377 of query aligns to 96:264/503 of Q8C165
Sites not aligning to the query:
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
26% identity, 78% coverage: 61:354/377 of query aligns to 75:377/408 of Q03154
Sites not aligning to the query:
3ki9A Crystal structure of staphylococcus aureus metallopeptidase (sapep/dape) in the mn2+ bound form (see paper)
36% identity, 21% coverage: 55:134/377 of query aligns to 74:151/467 of 3ki9A
Sites not aligning to the query:
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
32% identity, 34% coverage: 63:189/377 of query aligns to 129:254/507 of Q96KN2
Sites not aligning to the query:
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
23% identity, 92% coverage: 7:354/377 of query aligns to 15:376/407 of P37111
Sites not aligning to the query:
Q96KP4 Cytosolic non-specific dipeptidase; CNDP dipeptidase 2; Glutamate carboxypeptidase-like protein 1; Peptidase A; Threonyl dipeptidase; EC 3.4.13.18 from Homo sapiens (Human)
43% identity, 20% coverage: 65:140/377 of query aligns to 98:174/475 of Q96KP4
Sites not aligning to the query:
3dljA Crystal structure of human carnosine dipeptidase 1
40% identity, 19% coverage: 63:135/377 of query aligns to 98:170/471 of 3dljA
Sites not aligning to the query:
Q9D1A2 Cytosolic non-specific dipeptidase; CNDP dipeptidase 2; Glutamate carboxypeptidase-like protein 1; Threonyl dipeptidase; EC 3.4.13.18 from Mus musculus (Mouse) (see 2 papers)
50% identity, 13% coverage: 65:114/377 of query aligns to 98:147/475 of Q9D1A2
Sites not aligning to the query:
>N515DRAFT_0745 FitnessBrowser__Dyella79:N515DRAFT_0745
MSAVFDLTAELIRRRSVTPDDAGCQALLAGRLARVGFKVEHLRYGEVDNLWATHGEGGPL
LMFLGHTDVVPTGPAESWRSDPFEPAVRDGYLYGRGAADMKGSVAAMAVALEAFVTAHPD
HRGRVGFLMTSDEEGPTNLDGVRKVAEHFRASGERIDWCVVGEPSSKERLGDLIRVGRRG
SLSATLTVRGIQGHVAYPEKAKNPIHAFAPALAELAAERWDEGNVDFPPTSFQVSNLNAG
TGATNVIPGALVALVNFRYSTASRAEALRERVERILDRHKLDYALDWNLSGEPFLCPAGG
ALRDTVVSVCRDLCGVEPEQSTGGGTSDGRFIAPLGAEVVELGPVNATIHKVDECVAVAD
LDKLPSLYRAICERLLG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory