SitesBLAST
Comparing N515DRAFT_0879 FitnessBrowser__Dyella79:N515DRAFT_0879 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4bmsF Short chain alcohol dehydrogenase from ralstonia sp. Dsm 6428 in complex with NADPH
34% identity, 96% coverage: 7:252/257 of query aligns to 6:246/249 of 4bmsF
- active site: S137 (≠ N139), H147 (≠ S154), Y150 (= Y157), K154 (= K161), Q195 (≠ A202)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), N15 (≠ T16), S16 (= S17), I18 (≠ M19), R38 (≠ Q39), R39 (= R40), A59 (= A62), D60 (≠ N63), V61 (≠ L64), N87 (≠ A90), S88 (≠ A91), G89 (= G92), V110 (≠ L113), S137 (≠ N139), Y150 (= Y157), K154 (= K161), G181 (≠ A188), I183 (≠ V190), T185 (= T192), I187 (= I194)
5t2uA Short chain dehydrogenase/reductase family protein (see paper)
35% identity, 94% coverage: 11:251/257 of query aligns to 10:237/241 of 5t2uA
- active site: G17 (= G18), T135 (≠ S142), T145 (= T152), Y148 (= Y157), K152 (= K161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), G17 (= G18), R38 (≠ Q39), D39 (≠ R40), R42 (≠ K43), D60 (≠ L60), L61 (≠ T61), N83 (≠ A90), A84 (= A91), Y87 (≠ F94), I133 (= I140), T135 (≠ S142), Y148 (= Y157), K152 (= K161), P178 (= P187), P180 (≠ V189), T181 (≠ V190), T183 (= T192), T185 (≠ I199), T186 (≠ P200)
6ihhA Crystal structure of rasadh f12 from ralstonia.Sp in complex with NADPH and a6o
33% identity, 96% coverage: 7:252/257 of query aligns to 6:246/249 of 6ihhA
- binding (2R,3S)-2-ethyl-2-[(2E)-2-(6-methoxy-3,4-dihydro-2H-naphthalen-1-ylidene)ethyl]-3-oxidanyl-cyclopentan-1-one: S137 (≠ N139), H147 (≠ S154), Y150 (= Y157), L188 (≠ Y195), L246 (≠ V252)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), N15 (≠ T16), S16 (= S17), G17 (= G18), I18 (≠ M19), R38 (≠ Q39), R39 (= R40), D60 (≠ N63), V61 (≠ L64), N87 (≠ A90), S88 (≠ A91), G89 (= G92), V110 (≠ L113), T135 (≠ I137), S137 (≠ N139), Y150 (= Y157), K154 (= K161), P180 (= P187), G181 (≠ A188), A182 (≠ V189), I183 (≠ V190), T185 (= T192), S187 (≠ I194)
4hp8B Crystal structure of a putative 2-deoxy-d-gluconate 3-dehydrogenase from agrobacterium tumefaciens (target efi-506435) with bound NADP
36% identity, 98% coverage: 4:254/257 of query aligns to 5:245/246 of 4hp8B
- active site: G19 (= G18), S138 (= S142), V148 (≠ T152), Y151 (= Y157), K155 (= K161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G14), N17 (≠ T16), T18 (≠ S17), G19 (= G18), L20 (≠ M19), R40 (≠ Q39), R41 (= R40), D63 (≠ N63), F64 (≠ L64), N85 (≠ A90), G87 (= G92), I88 (≠ V93), I136 (= I140), Y151 (= Y157), K155 (= K161), P181 (= P187), G182 (≠ A188), I184 (≠ V190), T186 (= T192), N188 (≠ I194), T189 (≠ Y195)
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
35% identity, 96% coverage: 5:251/257 of query aligns to 2:241/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G14), M16 (= M19), D35 (≠ Q39), I36 (vs. gap), I62 (≠ L64), N88 (≠ A90), G90 (= G92), I138 (= I140), S140 (= S142), Y152 (= Y157), K156 (= K161), I185 (≠ V190)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
35% identity, 96% coverage: 5:251/257 of query aligns to 3:242/248 of Q9KJF1
- S15 (= S17) binding
- D36 (≠ Q39) binding
- D62 (≠ N63) binding
- I63 (≠ L64) binding
- N89 (≠ A90) binding
- Y153 (= Y157) binding
- K157 (= K161) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
5h5xC Crystal structure of nadh bound carbonyl reductase from streptomyces coelicolor
37% identity, 96% coverage: 5:250/257 of query aligns to 11:252/257 of 5h5xC
- active site: G24 (= G18), S151 (= S142), Y164 (= Y157), K168 (= K161)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G14), S23 (= S17), G24 (= G18), I25 (≠ M19), D44 (≠ Q39), F45 (≠ R40), L69 (= L64), D70 (≠ S65), N97 (≠ A90), A98 (= A91), Y164 (= Y157), K168 (= K161), P194 (= P187), G195 (≠ A188), I197 (≠ V190), T199 (= T192)
7nm8AAA Antimycin pathway standalone ketoreductase, AntM (see paper)
34% identity, 97% coverage: 6:255/257 of query aligns to 5:251/251 of 7nm8AAA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), S15 (≠ T16), R16 (≠ S17), G17 (= G18), I18 (≠ M19), H36 (≠ I36), Y37 (≠ V37), G38 (= G38), H39 (≠ Q39), L65 (= L64), N97 (≠ A90), G99 (= G92), S147 (= S142), Y160 (= Y157), K164 (= K161), G191 (≠ A188), T193 (≠ V190), T195 (= T192)
2d1yA Crystal structure of tt0321 from thermus thermophilus hb8 (see paper)
33% identity, 97% coverage: 5:254/257 of query aligns to 3:238/240 of 2d1yA
- active site: G16 (= G18), S135 (= S142), N145 (≠ S154), Y148 (= Y157), K152 (= K161)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), R15 (≠ S17), I17 (≠ M19), D36 (≠ G38), L37 (≠ Q39), R38 (= R40), V55 (= V57), D56 (≠ N63), L57 (= L64), N83 (≠ A90), A84 (= A91), A85 (≠ G92), I86 (≠ V93), V133 (≠ I140), S135 (= S142), Y148 (= Y157), K152 (= K161), P178 (= P187), G179 (≠ A188), I181 (≠ V190), T183 (= T192), A185 (vs. gap), V186 (≠ I194)
7do7A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NAD and l-rhamnose bound-form) (see paper)
36% identity, 96% coverage: 7:252/257 of query aligns to 5:251/256 of 7do7A
- active site: G16 (= G18), S146 (= S142), Y159 (= Y157)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), R15 (≠ S17), G16 (= G18), I17 (≠ M19), S37 (≠ R40), D66 (≠ L60), A67 (≠ T61), N93 (≠ A90), A94 (= A91), G95 (= G92), I96 (≠ V93), V144 (≠ I140), S145 (≠ G141), S146 (= S142), Y159 (= Y157), K163 (= K161), P189 (= P187), G190 (≠ A188), I192 (≠ V190), T194 (= T192), I196 (= I194)
- binding beta-L-rhamnopyranose: F99 (≠ P96), S146 (= S142), S148 (≠ W144), Q156 (≠ S154), Y159 (= Y157), N197 (≠ Y195), D235 (= D236), M236 (≠ K237), R238 (≠ S239)
7b81A Crystal structure of azotobacter vinelandii l-rhamnose 1-dehydrogenase (NAD bound-form) (see paper)
36% identity, 96% coverage: 7:252/257 of query aligns to 5:251/256 of 7b81A
- active site: G16 (= G18), S146 (= S142), Y159 (= Y157)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), S14 (≠ T16), R15 (≠ S17), I17 (≠ M19), D66 (≠ L60), A67 (≠ T61), N93 (≠ A90), A94 (= A91), G95 (= G92), I96 (≠ V93), T116 (vs. gap), V144 (≠ I140), S146 (= S142), Y159 (= Y157), K163 (= K161), P189 (= P187), G190 (≠ A188), I192 (≠ V190), T194 (= T192), I196 (= I194)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
32% identity, 97% coverage: 5:254/257 of query aligns to 3:247/248 of 6ixmC
- active site: G16 (= G18), S142 (= S142), Y155 (= Y157), K159 (= K161)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), S15 (= S17), G16 (= G18), I17 (≠ M19), D36 (≠ G38), I37 (≠ Q39), A61 (= A62), D62 (≠ N63), T63 (≠ L64), N89 (≠ A90), A90 (= A91), M140 (≠ I140), S142 (= S142), Y155 (= Y157), K159 (= K161), P185 (= P187), A186 (= A188), Y187 (≠ V189), I188 (≠ V190), L192 (≠ I194)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
30% identity, 97% coverage: 4:252/257 of query aligns to 2:241/244 of 6t77A
- active site: G16 (= G18), S138 (= S142), Y151 (= Y157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (≠ T16), R15 (≠ S17), T37 (= T44), L58 (≠ A62), N59 (= N63), V60 (≠ L64), A87 (= A91), G88 (= G92), I89 (≠ V93)
4za2D Crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d- gluconate dehydrogenase complexed with NAD+ (see paper)
32% identity, 97% coverage: 5:254/257 of query aligns to 8:246/247 of 4za2D
- binding nicotinamide-adenine-dinucleotide: G17 (= G14), D19 (≠ T16), L22 (≠ M19), I42 (≠ A41), D65 (≠ N63), M66 (≠ L64), N92 (≠ A90), A93 (= A91), G94 (= G92), L115 (= L113), I143 (= I140), S145 (= S142), Y158 (= Y157), K162 (= K161), G189 (= G197), M191 (≠ I199), T193 (≠ K201), N195 (≠ E203)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
32% identity, 98% coverage: 1:253/257 of query aligns to 2:243/244 of 4nbuB
- active site: G18 (= G18), N111 (= N114), S139 (= S142), Q149 (≠ S154), Y152 (= Y157), K156 (= K161)
- binding acetoacetyl-coenzyme a: D93 (≠ K97), K98 (≠ H102), S139 (= S142), N146 (≠ A151), V147 (≠ T152), Q149 (≠ S154), Y152 (= Y157), F184 (≠ V189), M189 (≠ I194), K200 (≠ G210)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), N17 (≠ S17), G18 (= G18), I19 (≠ M19), D38 (= D42), F39 (≠ K43), V59 (≠ A62), D60 (≠ N63), V61 (≠ L64), N87 (≠ A90), A88 (= A91), G89 (= G92), I90 (≠ V93), T137 (≠ I140), S139 (= S142), Y152 (= Y157), K156 (= K161), P182 (= P187), F184 (≠ V189), T185 (≠ V190), T187 (= T192), M189 (≠ I194)
Q6WVP7 NADP-dependent (R)-specific alcohol dehydrogenase; (R)-specific ADH; Ketoreductase; KRED; EC 1.1.1.- from Lentilactobacillus kefiri (Lactobacillus kefiri) (see paper)
28% identity, 99% coverage: 1:254/257 of query aligns to 1:251/252 of Q6WVP7
Sites not aligning to the query:
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
29% identity, 97% coverage: 4:252/257 of query aligns to 2:241/244 of P0A2C9
- M125 (≠ I129) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (≠ L234) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S235) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
6y0sAAA R-specific alcohol dehydrogenase (see paper)
28% identity, 98% coverage: 2:254/257 of query aligns to 1:250/251 of 6y0sAAA
7xqmB Indel-mutant short chain dehydrogenase bound to sah (see paper)
37% identity, 67% coverage: 84:256/257 of query aligns to 75:251/253 of 7xqmB
Sites not aligning to the query:
7ejhA Crystal structure of kred mutant-f147l/l153q/y190p/l199a/m205f/m206f and 2-hydroxyisoindoline-1,3-dione complex
28% identity, 99% coverage: 1:254/257 of query aligns to 2:252/253 of 7ejhA
- binding 2-oxidanylisoindole-1,3-dione: S144 (= S142), I145 (≠ M143), E146 (≠ Q147), Y157 (= Y157), V197 (≠ I199), F207 (≠ Q209)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G14), T17 (= T16), I20 (≠ M19), R40 (≠ Q39), H41 (≠ R40), D64 (≠ N63), A65 (≠ L64), N91 (≠ A90), A92 (= A91), V114 (≠ L113), M142 (≠ I140), S144 (= S142), Y157 (= Y157), K161 (= K161), P189 (= P187), G190 (≠ A188), P191 (≠ V189), I192 (≠ V190), T194 (= T192), P195 (= P193), L196 (≠ I194)
Query Sequence
>N515DRAFT_0879 FitnessBrowser__Dyella79:N515DRAFT_0879
MSKAFKDKKLLVVGGTSGMGLQTARMVLAEGGSAVIVGQRADKTEEARAQLAALGQVEAL
TANLSSDAGLAALLHAIDAQHRDIDLLVNAAGVFFPKSFLEHQPADYDQYMQLNKAFFFI
TQKVATHMIDAGRTGAIVNIGSMWAKQAIAATPSSAYSMAKAGLHALTQHLAMELAPKHI
RVNAVSPAVVQTPIYEGFIPKAEVHSALQGFNSFHPIGRVGTPQDVAEAIVFLLSDKASW
VTGAIWDVDGGVMAGRN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory