SitesBLAST
Comparing N515DRAFT_0916 FitnessBrowser__Dyella79:N515DRAFT_0916 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3in1A Crystal structure of a putative ribokinase in complex with adp from e.Coli
30% identity, 92% coverage: 9:296/312 of query aligns to 4:296/312 of 3in1A
- active site: R106 (= R110), G255 (= G255), A256 (= A256), G257 (= G257), D258 (= D258)
- binding adenosine-5'-diphosphate: N194 (= N196), K225 (= K226), G227 (= G228), G230 (= G231), A244 (= A245), T253 (≠ S253), N282 (= N282), A285 (≠ G285)
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
30% identity, 96% coverage: 8:308/312 of query aligns to 3:305/306 of 5eynA
- active site: G246 (= G255), A247 (= A256), G248 (= G257), D249 (= D258)
- binding adenosine-5'-diphosphate: H91 (≠ P107), T217 (≠ K226), G219 (= G228), A220 (≠ R229), A238 (= A247), V239 (= V248), T244 (≠ S253), G246 (= G255), A247 (= A256), G248 (= G257), F251 (= F260), N279 (= N282), G282 (= G285), A283 (≠ S286)
- binding beryllium trifluoride ion: G246 (= G255), G248 (= G257), D249 (= D258)
- binding beta-D-fructofuranose: D9 (≠ E14), D13 (= D18), G28 (≠ S45), A29 (≠ S46), N32 (≠ I49), F96 (≠ L112), F98 (= F115), R159 (vs. gap), D249 (= D258)
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
30% identity, 96% coverage: 8:308/312 of query aligns to 7:309/310 of 5yggA
- binding adenosine-5'-diphosphate: K188 (≠ V192), T221 (≠ K226), G223 (= G228), A242 (= A247), V243 (= V248), F255 (= F260), N283 (= N282), G286 (= G285), A287 (≠ S286)
- binding beta-D-fructofuranose: D13 (≠ E14), D17 (= D18), G32 (≠ S45), A33 (≠ S46), F100 (≠ L112), F102 (= F115), R163 (vs. gap), D253 (= D258)
8cqxA Ribokinase from t.Sp mutant a92g
33% identity, 97% coverage: 9:310/312 of query aligns to 2:300/300 of 8cqxA
- binding adenosine-5'-diphosphate: N179 (= N196), T217 (≠ K226), G219 (= G228), A220 (≠ R229), G222 (= G231), F250 (= F260), N272 (= N282), G275 (= G285), A276 (≠ S286), T279 (= T289)
- binding magnesium ion: D242 (= D252), T244 (= T254), A278 (≠ S288), S287 (≠ R297)
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
33% identity, 78% coverage: 44:286/312 of query aligns to 33:279/300 of 1v1bA
- active site: G248 (= G255), A249 (= A256), G250 (= G257), D251 (= D258)
- binding adenosine-5'-triphosphate: K219 (= K226), G221 (= G228), A238 (= A245), F239 (≠ L246), V241 (= V248), G248 (= G255), A249 (= A256), G250 (= G257), N275 (= N282), A279 (≠ S286)
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
33% identity, 78% coverage: 44:286/312 of query aligns to 33:279/309 of Q53W83
- GAEVN 34:38 (≠ SSSMI 45:49) binding
- YYR 103:105 (≠ F-- 115) binding
- R167 (≠ D174) binding
- S193 (≠ N196) binding
- 219:225 (vs. 226:232, 57% identical) binding
- GAGD 248:251 (= GAGD 255:258) binding
- D251 (= D258) binding
- N275 (= N282) binding
Sites not aligning to the query:
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
33% identity, 78% coverage: 44:286/312 of query aligns to 33:279/301 of 1v1aA
- active site: G248 (= G255), A249 (= A256), G250 (= G257), D251 (= D258)
- binding adenosine-5'-diphosphate: K219 (= K226), G221 (= G228), A222 (≠ R229), A249 (= A256), G250 (= G257), N275 (= N282), A279 (≠ S286)
- binding 2-keto-3-deoxygluconate: G34 (≠ S45), A35 (≠ S46), N38 (≠ I49), Y89 (≠ T101), R105 (vs. gap), R167 (≠ D174), G248 (= G255), D251 (= D258)
Sites not aligning to the query:
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
27% identity, 97% coverage: 7:309/312 of query aligns to 2:303/306 of 4xckA
- active site: A249 (≠ G255), A250 (= A256), G251 (= G257), D252 (= D258)
- binding adenosine-5'-diphosphate: T220 (≠ K226), G222 (= G228), S223 (≠ R229), V242 (= V248), T247 (≠ S253), A250 (= A256), F254 (= F260), H276 (≠ N282), A279 (≠ G285), V283 (≠ T289)
- binding alpha-D-ribofuranose: N11 (= N16), D13 (= D18), G39 (≠ S45), K40 (≠ S46), N43 (≠ I49), A95 (≠ T101), I107 (≠ L112), I109 (≠ T114), E140 (≠ R150), T248 (= T254), D252 (= D258)
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
26% identity, 93% coverage: 8:297/312 of query aligns to 3:297/308 of 3iq0B
- active site: G252 (= G255), A253 (= A256), G254 (= G257), D255 (= D258)
- binding adenosine-5'-triphosphate: S192 (≠ N196), K223 (= K226), G225 (= G228), E247 (≠ A250), A253 (= A256), G254 (= G257), F257 (= F260), N279 (= N282), G282 (= G285)
6znxC Ribokinase from thermus species
30% identity, 97% coverage: 9:310/312 of query aligns to 2:265/265 of 6znxC
6ilsB Structure of arabidopsis thaliana ribokinase complexed with ribose and atp (see paper)
28% identity, 96% coverage: 9:308/312 of query aligns to 5:309/313 of 6ilsB
- binding adenosine-5'-triphosphate: N189 (= N196), K225 (= K226), G227 (= G228), I246 (vs. gap), A248 (= A247), A257 (= A256), G258 (= G257), F261 (= F260), A286 (≠ G285), S287 (= S286)
- binding alpha-D-ribofuranose: N12 (= N16), D14 (= D18), G40 (≠ S45), K41 (≠ S46), N44 (≠ I49), E144 (≠ A148), D259 (= D258)
A1A6H3 Ribokinase; AtRBSK; RK; EC 2.7.1.15 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 96% coverage: 9:308/312 of query aligns to 71:375/379 of A1A6H3
Sites not aligning to the query:
- 1:74 mutation Missing: Loss of ribokinase activity.
P0DX97 Deoxyribokinase; dRK; ATP:2-deoxy-D-ribose 5-phosphotransferase; EC 2.7.1.229 from Salmonella typhi (see paper)
23% identity, 96% coverage: 9:309/312 of query aligns to 3:303/306 of P0DX97
- M10 (≠ N16) Important for substrate specificity; mutation to N: 2.5-fold decrease in Vmax for deoxyribokinase activity and 70-fold increase in KM for deoxyribose. 2-fold increase in KM for ribose.
2dcnA Crystal structure of 2-keto-3-deoxygluconate kinase from sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form)
23% identity, 85% coverage: 44:308/312 of query aligns to 33:305/308 of 2dcnA
- active site: G252 (= G255), A253 (= A256), G254 (= G257), D255 (= D258)
- binding adenosine-5'-diphosphate: D193 (≠ N196), K223 (= K226), G225 (= G228), P226 (≠ R229), G228 (= G231), V247 (≠ A250), G254 (= G257), I279 (≠ N282), S282 (≠ G285), V286 (≠ T289)
- binding 6-O-phosphono-beta-D-psicofuranosonic acid: G33 (= G44), F89 (≠ T101), Y105 (≠ V113), R107 (≠ F115), I136 (≠ F143), R165 (= R178), T251 (= T254), G252 (= G255), D255 (= D258), D291 (≠ G294)
3uboA The crystal structure of adenosine kinase from sinorhizobium meliloti
26% identity, 85% coverage: 44:309/312 of query aligns to 57:330/338 of 3uboA
- active site: R124 (= R110), G274 (= G255), A275 (= A256), G276 (= G257), D277 (= D258)
- binding adenosine: G57 (= G44), G58 (≠ S45), S59 (= S46), N62 (≠ I49), M126 (≠ L112), T128 (= T114), E155 (≠ S141), Y157 (≠ F143), G274 (= G255), D277 (= D258), P313 (≠ G294)
- binding adenosine-5'-diphosphate: N214 (= N196), T244 (≠ K226), S246 (≠ G228), E247 (≠ R229), G249 (= G231), L266 (≠ A247), A275 (= A256), G276 (= G257), N301 (= N282), A304 (≠ G285), I308 (≠ T289)
Sites not aligning to the query:
P0A9J6 Ribokinase; RK; EC 2.7.1.15 from Escherichia coli (strain K12) (see 3 papers)
26% identity, 86% coverage: 9:276/312 of query aligns to 7:273/309 of P0A9J6
Sites not aligning to the query:
1gqtB Activation of ribokinase by monovalent cations (see paper)
26% identity, 86% coverage: 9:276/312 of query aligns to 6:272/307 of 1gqtB
- active site: A251 (≠ G255), A252 (= A256), G253 (= G257), D254 (= D258)
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N196), T222 (≠ K226), G224 (= G228), S225 (≠ R229), A252 (= A256), G253 (= G257)
- binding cesium ion: D248 (= D252), I250 (≠ T254)
- binding alpha-D-ribofuranose: N13 (= N16), D15 (= D18), G41 (≠ S45), N45 (≠ I49), E142 (≠ R150), D254 (= D258)
Sites not aligning to the query:
1rk2A E. Coli ribokinase complexed with ribose and adp, solved in space group p212121 (see paper)
26% identity, 86% coverage: 9:276/312 of query aligns to 4:270/305 of 1rk2A
- active site: A249 (≠ G255), A250 (= A256), G251 (= G257), D252 (= D258)
- binding adenosine-5'-diphosphate: T220 (≠ K226), G222 (= G228), S223 (≠ R229), A250 (= A256), G251 (= G257)
- binding tetrafluoroaluminate ion: G213 (= G219), R215 (≠ T221)
- binding magnesium ion: D246 (= D252)
- binding alpha-D-ribofuranose: N11 (= N16), D13 (= D18), G38 (= G44), G39 (≠ S45), K40 (≠ S46), N43 (≠ I49), E140 (≠ R150), D252 (= D258)
Sites not aligning to the query:
4lbxA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with cytidine
26% identity, 81% coverage: 40:293/312 of query aligns to 55:314/331 of 4lbxA
- active site: R126 (= R110), G276 (= G255), A277 (= A256), G278 (= G257), D279 (= D258)
- binding adenosine: G59 (= G44), G60 (≠ S45), S61 (= S46), N64 (≠ I49), M128 (≠ L112), T130 (= T114), E157 (≠ S141), Y159 (≠ F143), T275 (= T254), D279 (= D258)
- binding 4-amino-1-beta-d-ribofuranosyl-2(1h)-pyrimidinone: T246 (≠ K226), S248 (≠ G228), G251 (= G231), C303 (≠ N282), A306 (≠ G285), I310 (≠ T289)
Sites not aligning to the query:
4k8kA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with 1-(4-methoxyphenyl)-1-cyclopropane and 2- aminoperimidine
26% identity, 81% coverage: 40:293/312 of query aligns to 55:314/331 of 4k8kA
- active site: R126 (= R110), G276 (= G255), A277 (= A256), G278 (= G257), D279 (= D258)
- binding 1-(4-methoxyphenyl)cyclopropanecarboxylic acid: P112 (vs. gap), R115 (= R97), M117 (≠ G99), Y131 (≠ F115)
- binding 1H-perimidin-2-amine: A84 (= A69), D85 (= D70), D89 (≠ S74)
- binding adenosine: G59 (= G44), G60 (≠ S45), S61 (= S46), N64 (≠ I49), M128 (≠ L112), T130 (= T114), E157 (≠ S141), Y159 (≠ F143), T275 (= T254), D279 (= D258)
Sites not aligning to the query:
Query Sequence
>N515DRAFT_0916 FitnessBrowser__Dyella79:N515DRAFT_0916
MTRSTPKRVLVVGEVNVDLVLKGLHAEPAPGQEVLADDFLMTPGSSSMICAMGLARLGNA
VAFHGRLGADAWGSYCLDALRDAGIDVASLQPEAALRTGITVSLSTPRDRSLVTFSGAIA
ALRAEDVSDALLAGAGHLHVSSFYLQKALRADIRQLFARARKAGLTLSLDPGFDPEQRWG
DDLRGVLEDVDVFLPNEEELRALTGENHVRKALAALDNGRTLIVAKRGRQGCAVLHDGKL
LVAPALAVEAVDSTGAGDSFDAGFLHAWLRGLPLRDCLRWGNACGSLSTRGIGGTTRQAT
AAEVTALLAGAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory