Comparing N515DRAFT_0926 FitnessBrowser__Dyella79:N515DRAFT_0926 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P35914 Hydroxymethylglutaryl-CoA lyase, mitochondrial; HL; HMG-CoA lyase; 3-hydroxy-3-methylglutarate-CoA lyase; EC 4.1.3.4 from Homo sapiens (Human) (see 11 papers)
57% identity, 99% coverage: 1:296/300 of query aligns to 26:321/325 of P35914
Sites not aligning to the query:
Q8TB92 3-hydroxy-3-methylglutaryl-CoA lyase, cytoplasmic; 3-hydroxy-3-methylglutaryl-CoA lyase-like protein 1; HMGCL-like 1; Endoplasmic reticulum 3-hydroxy-3-methylglutaryl-CoA lyase; er-cHL; EC 4.1.3.4 from Homo sapiens (Human) (see 2 papers)
58% identity, 98% coverage: 8:300/300 of query aligns to 78:370/370 of Q8TB92
Sites not aligning to the query:
3mp3B Crystal structure of human lyase in complex with inhibitor hg-coa (see paper)
58% identity, 96% coverage: 8:296/300 of query aligns to 6:294/296 of 3mp3B
2cw6A Crystal structure of human hmg-coa lyase: insights into catalysis and the molecular basis for hydroxymethylglutaric aciduria (see paper)
58% identity, 96% coverage: 8:296/300 of query aligns to 6:294/296 of 2cw6A
3mp5B Crystal structure of human lyase r41m in complex with hmg-coa (see paper)
58% identity, 96% coverage: 8:296/300 of query aligns to 6:294/296 of 3mp5B
1ydnA Crystal structure of the hmg-coa lyase from brucella melitensis, northeast structural genomics target lr35. (see paper)
58% identity, 92% coverage: 7:283/300 of query aligns to 3:279/283 of 1ydnA
P13703 Hydroxymethylglutaryl-CoA lyase; HL; HMG-CoA lyase; 3-hydroxy-3-methylglutarate-CoA lyase; EC 4.1.3.4 from Pseudomonas mevalonii (see paper)
54% identity, 95% coverage: 8:292/300 of query aligns to 4:288/301 of P13703
6ndsA Structure of an hmg-coa lyase from acenitobacter baumannii in complex with coenzyme a and 3-methylmalate
38% identity, 96% coverage: 10:296/300 of query aligns to 10:295/305 of 6ndsA
6ktqA Crystal structure of catalytic domain of homocitrate synthase from sulfolobus acidocaldarius (sahcs(dram)) in complex with alpha- ketoglutarate/zn2+/coa (see paper)
26% identity, 77% coverage: 8:239/300 of query aligns to 22:247/399 of 6ktqA
2nx9B Crystal structure of the carboxyltransferase domain of the oxaloacetate decarboxylase na+ pump from vibrio cholerae (see paper)
34% identity, 40% coverage: 161:281/300 of query aligns to 160:273/453 of 2nx9B
Sites not aligning to the query:
Q9Y823 Homocitrate synthase, mitochondrial; HCS; EC 2.3.3.14 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see 2 papers)
22% identity, 78% coverage: 6:239/300 of query aligns to 33:255/418 of Q9Y823
Sites not aligning to the query:
3ivtB Homocitrate synthase lys4 bound to 2-og (see paper)
22% identity, 78% coverage: 6:239/300 of query aligns to 28:250/400 of 3ivtB
Q9FN52 Methylthioalkylmalate synthase 3, chloroplastic; 2-isopropylmalate synthase 2; Methylthioalkylmalate synthase-like; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
23% identity, 86% coverage: 6:264/300 of query aligns to 83:342/503 of Q9FN52
Q9FG67 Methylthioalkylmalate synthase 1, chloroplastic; 2-isopropylmalate synthase 3; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
23% identity, 95% coverage: 4:287/300 of query aligns to 80:377/506 of Q9FG67
3mi3A Homocitrate synthase lys4 bound to lysine (see paper)
23% identity, 78% coverage: 6:239/300 of query aligns to 10:221/370 of 3mi3A
3ivsA Homocitrate synthase lys4 (see paper)
23% identity, 78% coverage: 6:239/300 of query aligns to 10:219/364 of 3ivsA
P11154 Pyruvate carboxylase 1; Pyruvic carboxylase 1; PCB 1; EC 6.4.1.1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
31% identity, 27% coverage: 161:240/300 of query aligns to 717:796/1178 of P11154
Sites not aligning to the query:
Q70AC7 Methylmalonyl-CoA carboxyltransferase 5S subunit; Transcarboxylase 5S subunit; EC 2.1.3.1 from Propionibacterium freudenreichii subsp. shermanii (see paper)
30% identity, 39% coverage: 157:274/300 of query aligns to 163:275/505 of Q70AC7
Sites not aligning to the query:
1rr2A Propionibacterium shermanii transcarboxylase 5s subunit bound to 2- ketobutyric acid (see paper)
30% identity, 39% coverage: 157:274/300 of query aligns to 161:273/472 of 1rr2A
Sites not aligning to the query:
1rqeA Propionibacterium shermanii transcarboxylase 5s subunit bound to oxaloacetate (see paper)
30% identity, 39% coverage: 157:274/300 of query aligns to 161:273/472 of 1rqeA
Sites not aligning to the query:
>N515DRAFT_0926 FitnessBrowser__Dyella79:N515DRAFT_0926
MNSPDNHVRIVEVGARDGLQNEKTLLPADVKIALIDRLSSTGLSTIEATSFVSPKWVPQL
ADAAEVFQGIRKVPGVSYPVLVPNEQGYRRARDVGATEVAVFTAASEAFNRKNINAGIDE
SIERFRPVLELARADGVKVRGYVSTVLGCPYQGEVPVADVVRVAARLHQLGCHEISLGDT
IGVGTPAKARAMLKAVAAEVPMAALAVHFHDTYGQALANILSCLEEGVRVVDSAVSGTGG
CPYAKGATGNVASEDVVYMLHGMGMQTGVDLDILVATGAWLAAQLHKETASRVTRARTAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory