SitesBLAST
Comparing N515DRAFT_0938 FitnessBrowser__Dyella79:N515DRAFT_0938 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6bn2A Crystal structure of acetyl-coa acetyltransferase from elizabethkingia anophelis nuhp1
49% identity, 98% coverage: 6:391/394 of query aligns to 4:390/393 of 6bn2A
P45359 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; CaTHL; EC 2.3.1.9 from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) (see paper)
51% identity, 98% coverage: 5:391/394 of query aligns to 3:390/392 of P45359
- V77 (≠ A79) mutation to Q: 3-fold increase in thiolase activity, prevents disulfide bond formation under oxidized condition and results in the loss of regulatory mechanism based on redox-switch modulation; when associated with Y-153 and K-286.
- C88 (= C90) modified: Disulfide link with 378, In inhibited form
- S96 (≠ M98) binding
- N153 (≠ D154) mutation to Y: 3-fold increase in thiolase activity, prevents disulfide bond formation under oxidized condition and results in the loss of regulatory mechanism based on redox-switch modulation; when associated with Q-77 and K-286.
- GS 279:280 (≠ AT 280:281) binding
- A286 (≠ E287) mutation to K: 3-fold increase in thiolase activity, prevents disulfide bond formation under oxidized condition and results in the loss of regulatory mechanism based on redox-switch modulation; when associated with Q-77 and Y-153.
- C378 (= C379) modified: Disulfide link with 88, In inhibited form
- A386 (= A387) binding
4xl4A Crystal structure of thiolase from clostridium acetobutylicum in complex with coa (see paper)
50% identity, 98% coverage: 5:391/394 of query aligns to 3:390/392 of 4xl4A
- active site: C88 (= C90), H348 (= H349), S378 (≠ C379), G380 (= G381)
- binding coenzyme a: L148 (= L149), H156 (≠ A157), R220 (≠ G221), L231 (= L231), A243 (= A244), S247 (= S248), F319 (= F320), H348 (= H349)
1ou6A Biosynthetic thiolase from zoogloea ramigera in complex with acetyl-o- pantetheine-11-pivalate
50% identity, 99% coverage: 2:393/394 of query aligns to 1:392/392 of 1ou6A
- active site: C89 (= C90), H348 (= H349), C378 (= C379), G380 (= G381)
- binding pantothenyl-aminoethanol-acetate pivalic acid: L148 (= L149), H156 (≠ A157), M157 (= M158), F235 (= F235), A243 (= A244), S247 (= S248), A318 (= A319), F319 (= F320), H348 (= H349)
2vu2A Biosynthetic thiolase from z. Ramigera. Complex with s-pantetheine-11- pivalate. (see paper)
50% identity, 99% coverage: 5:393/394 of query aligns to 1:389/389 of 2vu2A
- active site: C86 (= C90), H345 (= H349), C375 (= C379), G377 (= G381)
- binding (3R)-3-hydroxy-2,2-dimethyl-4-oxo-4-({3-oxo-3-[(2-sulfanylethyl)amino]propyl}amino)butyl 2,2-dimethylpropanoate: H153 (≠ A157), M154 (= M158), F232 (= F235), S244 (= S248), G245 (≠ S249), F316 (= F320), H345 (= H349)
1dm3A Acetylated biosynthetic thiolase from zoogloea ramigera in complex with acetyl-coa (see paper)
50% identity, 99% coverage: 5:393/394 of query aligns to 1:389/389 of 1dm3A
- active site: C86 (= C90), H345 (= H349), C375 (= C379), G377 (= G381)
- binding acetyl coenzyme *a: C86 (= C90), L145 (= L149), H153 (≠ A157), M154 (= M158), R217 (≠ G221), S224 (≠ K227), M225 (≠ V228), A240 (= A244), S244 (= S248), M285 (≠ F289), A315 (= A319), F316 (= F320), H345 (= H349), C375 (= C379)
1dlvA Biosynthetic thiolase from zoogloea ramigera in complex with coa (see paper)
50% identity, 99% coverage: 5:393/394 of query aligns to 1:389/389 of 1dlvA
- active site: C86 (= C90), H345 (= H349), C375 (= C379), G377 (= G381)
- binding coenzyme a: C86 (= C90), L145 (= L149), H153 (≠ A157), M154 (= M158), R217 (≠ G221), L228 (= L231), A240 (= A244), S244 (= S248), H345 (= H349)
2vu1A Biosynthetic thiolase from z. Ramigera. Complex of with o-pantheteine- 11-pivalate. (see paper)
50% identity, 99% coverage: 5:393/394 of query aligns to 3:391/391 of 2vu1A
2wkuA Biosynthetic thiolase from z. Ramigera. The n316h mutant. (see paper)
50% identity, 99% coverage: 5:393/394 of query aligns to 1:389/389 of 2wkuA
- active site: C86 (= C90), H345 (= H349), C375 (= C379), G377 (= G381)
- binding D-mannose: S6 (≠ G10), A7 (= A11), R38 (≠ Q42), K182 (≠ R186), D194 (≠ G198), V280 (≠ Q284), D281 (≠ E285), T287 (= T291), P331 (≠ H335), S332 (≠ A336), V334 (≠ L338), V336 (= V340), F360 (≠ N364)
1m1oA Crystal structure of biosynthetic thiolase, c89a mutant, complexed with acetoacetyl-coa (see paper)
50% identity, 99% coverage: 5:393/394 of query aligns to 2:390/390 of 1m1oA
- active site: A87 (≠ C90), H346 (= H349), C376 (= C379), G378 (= G381)
- binding acetoacetyl-coenzyme a: L86 (≠ V89), A87 (≠ C90), L146 (= L149), H154 (≠ A157), M155 (= M158), R218 (≠ G221), S225 (≠ K227), M226 (≠ V228), A241 (= A244), G242 (≠ A245), S245 (= S248), A316 (= A319), F317 (= F320), H346 (= H349), I377 (= I380), G378 (= G381)
P07097 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 from Shinella zoogloeoides (Crabtreella saccharophila) (see 2 papers)
50% identity, 100% coverage: 1:393/394 of query aligns to 1:392/392 of P07097
- Q64 (= Q65) mutation to A: Slightly lower activity.
- C89 (= C90) mutation to A: Loss of activity.
- C378 (= C379) mutation to G: Loss of activity.
6aqpA Aspergillus fumigatus cytosolic thiolase: acetylated enzyme in complex with coa and potassium ions
51% identity, 99% coverage: 5:393/394 of query aligns to 7:397/397 of 6aqpA
- active site: C93 (= C90), H353 (= H349), C383 (= C379), G385 (= G381)
- binding coenzyme a: C93 (= C90), L153 (= L149), Y188 (≠ V184), N226 (≠ R222), N228 (≠ D224), K231 (= K227), A248 (= A244), P249 (≠ A245), S252 (= S248), A323 (= A319), F324 (= F320), H353 (= H349)
6aqpC Aspergillus fumigatus cytosolic thiolase: acetylated enzyme in complex with coa and potassium ions
51% identity, 99% coverage: 5:393/394 of query aligns to 7:399/399 of 6aqpC
- active site: C93 (= C90), H355 (= H349), C385 (= C379), G387 (= G381)
- binding acetyl coenzyme *a: C93 (= C90), L153 (= L149), M162 (= M158), Y188 (≠ V184), N230 (≠ D224), K233 (= K227), L234 (≠ V228), I237 (≠ L231), A250 (= A244), P251 (≠ A245), S254 (= S248), F295 (= F289), A325 (= A319), F326 (= F320), H355 (= H349)
Q4WCL5 Acetyl-CoA acetyltransferase erg10B, cytosolic; Acetoacetyl-CoA thiolase erg10B; ACAT; Cytosolic thiolase erg10B; CT; Ergosterol biosynthesis protein 10B; EC 2.3.1.9 from Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) (Neosartorya fumigata)
51% identity, 99% coverage: 5:393/394 of query aligns to 6:398/398 of Q4WCL5
- Y187 (≠ V184) binding
- N229 (≠ D224) binding
- K232 (= K227) binding
- A249 (= A244) binding
- P250 (≠ A245) binding
- S252 (= S247) binding
- S253 (= S248) binding
- V350 (≠ C345) binding
- N385 (≠ I380) binding
P41338 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Ergosterol biosynthesis protein 10; EC 2.3.1.9 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
50% identity, 98% coverage: 5:391/394 of query aligns to 4:396/398 of P41338
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylserine
2ib8D Crystallographic and kinetic studies of human mitochondrial acetoacetyl-coa thiolase (t2): the importance of potassium and chloride for its structure and function (see paper)
50% identity, 98% coverage: 6:393/394 of query aligns to 8:393/393 of 2ib8D
P24752 Acetyl-CoA acetyltransferase, mitochondrial; Acetoacetyl-CoA thiolase; T2; EC 2.3.1.9 from Homo sapiens (Human) (see 6 papers)
50% identity, 98% coverage: 6:393/394 of query aligns to 42:427/427 of P24752
- N93 (≠ C57) to S: in 3KTD; decreased acetyl-CoA C-acyltransferase activity; less than 10% of the degradative/thiolase activity; dbSNP:rs120074145
- N158 (= N122) to D: in 3KTD; loss of acetyl-CoA C-acyltransferase activity; no degradative/thiolase activity; dbSNP:rs148639841
- G183 (= G148) to R: in 3KTD; no activity; dbSNP:rs120074141
- Y219 (≠ V184) binding ; binding
- RVD 258:260 (≠ RSD 222:224) binding
- K263 (= K227) binding
- A280 (= A244) binding
- A281 (= A245) binding
- A283 (≠ S247) binding
- S284 (= S248) binding
- T297 (≠ S261) to M: in 3KTD; decreased protein abundance; decreased acetyl-CoA C-acyltransferase activity; less than 10% of the degradative/thiolase activity; dbSNP:rs886041122
- A301 (= A265) to P: in 3KTD; loss of acetyl-CoA C-acyltransferase activity; no degradative/thiolase activity; dbSNP:rs1420321267
- I312 (= I276) to T: in 3KTD; decreased protein stability; decreased acetyl-CoA C-acyltransferase activity; less than 10% of the degradative/thiolase activity; dbSNP:rs120074146
- A333 (≠ I297) to P: in 3KTD; loss of protein solubility; loss of acetyl-CoA C-acyltransferase activity; no degradative/thiolase activity; dbSNP:rs120074147
- A380 (= A344) to T: in 3KTD; decreased protein stability; dbSNP:rs120074140
- V381 (≠ C345) binding
Sites not aligning to the query:
- 5 A → P: in dbSNP:rs3741056
1wl4A Human cytosolic acetoacetyl-coa thiolase complexed with coa (see paper)
48% identity, 98% coverage: 6:391/394 of query aligns to 5:392/394 of 1wl4A
- active site: C89 (= C90), H350 (= H349), C380 (= C379), G382 (= G381)
- binding coenzyme a: L148 (= L149), M157 (= M158), R220 (≠ G221), Y234 (≠ A234), P245 (≠ A244), A246 (= A245), S249 (= S248), A320 (= A319), F321 (= F320), H350 (= H349)
P14611 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
52% identity, 99% coverage: 1:391/394 of query aligns to 1:391/393 of P14611
- C88 (= C90) active site, Acyl-thioester intermediate; mutation to S: Almost complete loss of acetoacetyl-CoA thiolase activity.
- H156 (≠ A157) mutation to A: Almost complete loss of acetoacetyl-CoA thiolase activity.
- F219 (≠ Q219) mutation to A: About 50% loss of acetoacetyl-CoA thiolase activity.; mutation to Y: 2-fold increase of acetoacetyl-CoA thiolase activity.
- R221 (≠ G221) mutation to A: Almost complete loss of acetoacetyl-CoA thiolase activity.
- S248 (= S248) mutation to A: About 40% loss of acetoacetyl-CoA thiolase activity.
- H349 (= H349) mutation to A: Almost complete loss of acetoacetyl-CoA thiolase activity.
- C379 (= C379) mutation to S: Almost complete loss of acetoacetyl-CoA thiolase activity.
Q9BWD1 Acetyl-CoA acetyltransferase, cytosolic; Acetyl-CoA transferase-like protein; Cytosolic acetoacetyl-CoA thiolase; EC 2.3.1.9 from Homo sapiens (Human) (see 2 papers)
48% identity, 98% coverage: 6:391/394 of query aligns to 8:395/397 of Q9BWD1
- K211 (= K209) to R: in dbSNP:rs25683
- R223 (≠ G221) binding
- S226 (= S223) binding
- S252 (= S248) binding
Query Sequence
>N515DRAFT_0938 FitnessBrowser__Dyella79:N515DRAFT_0938
MSDVSVVIAGAKRTAIGSFLGQFTGVPTPVLGATAIKAALEQAGIAAQDVNEVLMGCVLP
ANLGQAPARQAALKAGLPAAVGCTTVNKVCGSGMKAIMLGHDLIKAGSAAVVVAGGMESM
TNAPHMVNARTGIRYGDGQLVDHMAWDGLTNPYDGKAMGVFGELCADKYHFTREEQDAFA
IESVKRAQAAQQNGAFAGEIVPVTVAGRKGDVVVDTDEQPGRSDIAKVPSLKPAFRKENG
TITAASSSSISDGAAAVVLLSADDAKARGLQPLARIVAHATHSQEPEWFTTAPVSAIQKV
LDKAGWKVDDVDLFEVNEAFAVVAMAPMRELGIPHAKLNVNGGACALGHPIGASGTRLVV
TLLNALQTRGLKRGVASLCIGGGEATAIAVELLG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory