Comparing N515DRAFT_0954 FitnessBrowser__Dyella79:N515DRAFT_0954 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1eyyA Crystal structure of the NADP+ dependent aldehyde dehydrogenase from vibrio harveyi. (see paper)
38% identity, 93% coverage: 27:521/533 of query aligns to 5:501/504 of 1eyyA
8hapB Crystal structure of thermostable acetaldehyde dehydrogenase from hyperthermophilic archaeon sulfolobus tokodaii (see paper)
25% identity, 76% coverage: 49:451/533 of query aligns to 24:423/466 of 8hapB
8hapA Crystal structure of thermostable acetaldehyde dehydrogenase from hyperthermophilic archaeon sulfolobus tokodaii (see paper)
25% identity, 76% coverage: 49:451/533 of query aligns to 24:423/466 of 8hapA
P17202 Aminoaldehyde dehydrogenase BADH; 4-trimethylammoniobutyraldehyde dehydrogenase BADH; Aminobutyraldehyde dehydrogenase BADH; Betaine aldehyde dehydrogenase; SoBADH; EC 1.2.1.-; EC 1.2.1.47; EC 1.2.1.19; EC 1.2.1.8 from Spinacia oleracea (Spinach) (see 3 papers)
24% identity, 80% coverage: 5:430/533 of query aligns to 4:428/497 of P17202
Sites not aligning to the query:
8vr1A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (ctp bound)
27% identity, 77% coverage: 9:420/533 of query aligns to 5:413/488 of 8vr1A
8vr0A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (gmp bound)
27% identity, 77% coverage: 9:420/533 of query aligns to 5:413/488 of 8vr0A
8vqzA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (cmp bound)
27% identity, 77% coverage: 9:420/533 of query aligns to 5:413/488 of 8vqzA
8vqwC Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (coa bound)
27% identity, 77% coverage: 9:420/533 of query aligns to 5:413/488 of 8vqwC
8vj3A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (fad bound)
27% identity, 77% coverage: 9:420/533 of query aligns to 5:413/488 of 8vj3A
8uzoA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (adp bound)
27% identity, 77% coverage: 9:420/533 of query aligns to 5:413/488 of 8uzoA
8uznA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (amp bound)
27% identity, 77% coverage: 9:420/533 of query aligns to 5:413/488 of 8uznA
8uzmA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (NADPH bound)
27% identity, 77% coverage: 9:420/533 of query aligns to 5:413/488 of 8uzmA
4v37A Crystal structure of betaine aldehyde dehydrogenase from spinach showing a thiohemiacetal with 3-aminopropionaldehyde
24% identity, 80% coverage: 5:430/533 of query aligns to 2:426/495 of 4v37A
Sites not aligning to the query:
3ju8A Crystal structure of succinylglutamic semialdehyde dehydrogenase from pseudomonas aeruginosa.
28% identity, 78% coverage: 47:461/533 of query aligns to 38:442/486 of 3ju8A
Sites not aligning to the query:
3vz3A Structural insights into substrate and cofactor selection by sp2771 (see paper)
26% identity, 74% coverage: 31:427/533 of query aligns to 6:393/453 of 3vz3A
Sites not aligning to the query:
1wndA Escherichia coli ydcw gene product is a medium-chain aldehyde dehydrogenase as determined by kinetics and crystal structure (see paper)
25% identity, 69% coverage: 63:428/533 of query aligns to 54:414/474 of 1wndA
Sites not aligning to the query:
1wnbB Escherichia coli ydcw gene product is a medium-chain aldehyde dehydrogenase (complexed with nadh and betaine aldehyde) (see paper)
25% identity, 69% coverage: 63:428/533 of query aligns to 54:414/474 of 1wnbB
Sites not aligning to the query:
1wnbA Escherichia coli ydcw gene product is a medium-chain aldehyde dehydrogenase (complexed with nadh and betaine aldehyde) (see paper)
25% identity, 69% coverage: 63:428/533 of query aligns to 54:414/474 of 1wnbA
Sites not aligning to the query:
P77674 Gamma-aminobutyraldehyde dehydrogenase; ABALDH; 1-pyrroline dehydrogenase; 4-aminobutanal dehydrogenase; 5-aminopentanal dehydrogenase; EC 1.2.1.19; EC 1.2.1.- from Escherichia coli (strain K12) (see paper)
25% identity, 69% coverage: 63:428/533 of query aligns to 54:414/474 of P77674
6fkuA Structure and function of aldehyde dehydrogenase from thermus thermophilus: an enzyme with an evolutionarily-distinct c-terminal arm (recombinant protein with shortened c-terminal, in complex with NADP) (see paper)
25% identity, 74% coverage: 31:427/533 of query aligns to 33:439/511 of 6fkuA
Sites not aligning to the query:
>N515DRAFT_0954 FitnessBrowser__Dyella79:N515DRAFT_0954
MTTQPAPVQPVLIDGDWRAASAPVGQFRAENPTTGEAIGPAFPICGAADVEAALAAATAA
AAELAATPPERIAAFLEAYADAIEADAEALVDIAHAETALPKQPRLAAVELPRTTNQLRL
AAKAVRSYAWTQPVIDTAANLRSHLAPLGKPVLVFGPNNFPFAFNAIAGSDFASAIAARN
PVIAKAHPSHPGTSERLARAAFAALRQAGLPAASVQMLYHFDHAIGGKLAGDARLGAIGF
TGSRAGGLALKAAADAAGIPAYVELSSVNPVFLLPGALAERGIALAQEFFTSCTMGSGQF
CTNPGVVIVPRGEAGDAFVEAAKAHFAAAAPSVLFSGGVLEHLQKGIATLRAAGAQLLAG
GDTGSPGYRHAPTLLEVDATQFLREPQALQTEAFGPASLLVRVDGVAQMVQVATAFEGNL
TGTLYANSADDAAWNDVAQALRPRVGRLIANRMPTGVAVSAAMNHGGPYPSTGHPGFTAV
GMPAAIRRFAALHSYDNVPEHLLPPELRDHNPGGVARQIDGCWCVDDLETKQA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory