Comparing N515DRAFT_0955 FitnessBrowser__Dyella79:N515DRAFT_0955 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3na8A Crystal structure of a putative dihydrodipicolinate synthetase from pseudomonas aeruginosa
37% identity, 94% coverage: 4:287/301 of query aligns to 1:280/291 of 3na8A
7mjfA Crystal structure of candidatus liberibacter solanacearum dihydrodipicolinate synthase with pyruvate and succinic semi-aldehyde bound in active site
29% identity, 97% coverage: 6:297/301 of query aligns to 1:290/296 of 7mjfA
7lvlA Dihydrodipicolinate synthase bound with allosteric inhibitor (s)- lysine from candidatus liberibacter solanacearum
29% identity, 97% coverage: 6:297/301 of query aligns to 1:290/296 of 7lvlA
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
31% identity, 97% coverage: 6:298/301 of query aligns to 1:290/294 of Q8UGL3
4pfmA Shewanella benthica dhdps with lysine and pyruvate
38% identity, 74% coverage: 8:229/301 of query aligns to 4:220/295 of 4pfmA
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
30% identity, 97% coverage: 6:298/301 of query aligns to 1:288/292 of Q07607
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
31% identity, 97% coverage: 6:298/301 of query aligns to 1:290/294 of 4i7wA
3di1B Crystal structure of the staphylococcus aureus dihydrodipicolinate synthase-pyruvate complex (see paper)
28% identity, 95% coverage: 6:292/301 of query aligns to 4:287/291 of 3di1B
Q5HG25 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Staphylococcus aureus (strain COL) (see paper)
28% identity, 95% coverage: 6:292/301 of query aligns to 4:287/295 of Q5HG25
5t25A Kinetic, spectral and structural characterization of the slow binding inhibitor acetopyruvate with dihydrodipicolinate synthase from escherichia coli.
29% identity, 96% coverage: 6:294/301 of query aligns to 2:290/293 of 5t25A
2atsA Dihydrodipicolinate synthase co-crystallised with (s)-lysine
29% identity, 96% coverage: 6:294/301 of query aligns to 1:289/292 of 2atsA
P0A6L2 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Escherichia coli (strain K12) (see 7 papers)
29% identity, 96% coverage: 6:294/301 of query aligns to 1:289/292 of P0A6L2
3i7sA Dihydrodipicolinate synthase mutant - k161a - with the substrate pyruvate bound in the active site. (see paper)
29% identity, 96% coverage: 6:294/301 of query aligns to 1:289/292 of 3i7sA
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
36% identity, 70% coverage: 8:218/301 of query aligns to 3:212/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
36% identity, 70% coverage: 8:218/301 of query aligns to 3:212/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
36% identity, 70% coverage: 8:218/301 of query aligns to 3:212/291 of 3tdfA
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
36% identity, 70% coverage: 8:218/301 of query aligns to 3:212/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
36% identity, 70% coverage: 8:218/301 of query aligns to 3:212/291 of 3rk8A
Sites not aligning to the query:
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
36% identity, 70% coverage: 8:218/301 of query aligns to 3:212/291 of 3pueB
Sites not aligning to the query:
1xxxA Crystal structure of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis (see paper)
38% identity, 67% coverage: 10:210/301 of query aligns to 11:208/296 of 1xxxA
>N515DRAFT_0955 FitnessBrowser__Dyella79:N515DRAFT_0955
MSNASIWRGVIPAITTPFTADGQVDHAFLGKHANQLIDAGCTGIVPLGSLGEAATLSFEE
KVEIIRTLVKALNGRAPVIPGIAALSTAEAVRLAKEAKALGCSGLMVLPPYVYSTDWREM
GAHLRAVIAATDLPCMLYNNPVAYKTDFAPEQIAELAHEFPNVQAVKESSGDVRRFAGIR
ALLGDRVELLVGMDDAIVEGVAMGARGWIAGLVNAYPKESVKLFELARDGGADAALELYR
WFLPLLRLDTVPTFVQLIKLVQAKVGMGSEQVRAPRLAVAGAEREAALRVIDHAIAHAPK
V
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory