Comparing N515DRAFT_0970 FitnessBrowser__Dyella79:N515DRAFT_0970 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7zlaB Cryo-em structure of holo-pdxr from bacillus clausii bound to its target DNA in the half-closed conformation (see paper)
32% identity, 95% coverage: 20:484/491 of query aligns to 8:449/458 of 7zlaB
Sites not aligning to the query:
7zn5B Cryo-em structure of holo-pdxr from bacillus clausii bound to its target DNA in the closed conformation, c2 symmetry. (see paper)
31% identity, 95% coverage: 21:484/491 of query aligns to 6:426/435 of 7zn5B
3wx9A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, gla, 4ad, 2og, glu and kya
31% identity, 72% coverage: 139:491/491 of query aligns to 40:398/404 of 3wx9A
Sites not aligning to the query:
3av7A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products
31% identity, 72% coverage: 139:491/491 of query aligns to 40:398/404 of 3av7A
Sites not aligning to the query:
3aowC Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with akg
31% identity, 72% coverage: 139:491/491 of query aligns to 40:398/404 of 3aowC
Sites not aligning to the query:
3aovA Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with plp
31% identity, 72% coverage: 139:491/491 of query aligns to 40:398/404 of 3aovA
7pq9AAA PLP-dependent aminotransferase family protein (see paper)
33% identity, 69% coverage: 146:484/491 of query aligns to 17:353/367 of 7pq9AAA
5t4kA Plp and gaba trigger gabr-mediated transcription regulation in bacillus subsidies via external aldimine formation (see paper)
32% identity, 70% coverage: 144:487/491 of query aligns to 14:353/360 of 5t4kA
Sites not aligning to the query:
5t4jB Plp and gaba trigger gabr-mediated transcription regulation in bacillus subsidies via external aldimine formation (see paper)
32% identity, 70% coverage: 144:487/491 of query aligns to 14:353/360 of 5t4jB
Sites not aligning to the query:
6uxzB (S)-4-amino-5-phenoxypentanoate as a selective agonist of the transcription factor gabr (see paper)
31% identity, 70% coverage: 144:487/491 of query aligns to 13:352/358 of 6uxzB
Sites not aligning to the query:
5x03B Crystal structure of thE C-terminal domain of bacillus subtilis gabr reveals a closed conformation by the binding of gamma-aminobutyric acid, inducing the transcriptional activation (see paper)
32% identity, 70% coverage: 144:487/491 of query aligns to 13:357/365 of 5x03B
1wstA Crystal structure of multiple substrate aminotransferase (msat) from thermococcus profundus
28% identity, 72% coverage: 139:491/491 of query aligns to 37:396/403 of 1wstA
2zc0A Crystal structure of an archaeal alanine:glyoxylate aminotransferase (see paper)
28% identity, 71% coverage: 139:487/491 of query aligns to 42:397/405 of 2zc0A
3cbfA Crystal structure of lysn, alpha-aminoadipate aminotransferase, from thermus thermophilus hb27 (see paper)
33% identity, 73% coverage: 135:491/491 of query aligns to 32:386/392 of 3cbfA
Sites not aligning to the query:
2egyA Crystal structure of lysn, alpha-aminoadipate aminotransferase (substrate free form), from thermus thermophilus hb27
33% identity, 73% coverage: 135:491/491 of query aligns to 32:386/392 of 2egyA
2z1yA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27
33% identity, 73% coverage: 135:491/491 of query aligns to 28:382/389 of 2z1yA
2zyjA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-glutamate), from thermus thermophilus hb27 (see paper)
33% identity, 73% coverage: 135:491/491 of query aligns to 36:390/397 of 2zyjA
Sites not aligning to the query:
Q72LL6 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; Alpha-aminoadipate aminotransferase; AAA-AT; AadAT; EC 2.6.1.39 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see 2 papers)
33% identity, 73% coverage: 135:491/491 of query aligns to 36:390/397 of Q72LL6
Sites not aligning to the query:
1vp4A Crystal structure of a putative aminotransferase (tm1131) from thermotoga maritima msb8 at 1.82 a resolution
24% identity, 67% coverage: 135:462/491 of query aligns to 42:383/420 of 1vp4A
8tn3A Structure of s. Hygroscopicus aminotransferase mppq complexed with pyridoxamine 5'-phosphate (pmp) (see paper)
31% identity, 52% coverage: 194:450/491 of query aligns to 82:348/388 of 8tn3A
>N515DRAFT_0970 FitnessBrowser__Dyella79:N515DRAFT_0970
MPRASTSFLPPIALEAGSGVPIYQQLSEWFRRAIADGQLRPGQRVPSTRSLATELRVSRL
PVLSAYEQLLAEGYLQSFVGAGTRVAPSIPTAAPKPSRPRLAAVPVARRDATRRVAQRVA
TMRAPEQTWLDSQGAFRVGLPALEHFPSALWAKLLNRHARAPSTESLVYGDPRGCPLLRE
AIADYLGAVRAVRVDAAQVLITTGSQQGVQICAHALLDAGDRAWLEDPGYPGARQAFGTI
GARIVPVPVDQEGLDVAEGIRRAPDARLVYTSPSHQFPLGMTLSAARRMQLLRWAARADA
WVVEDDYDSEYRFGGRPVASLQGLDTEERVIYVGTFSKVMFPSLRLGYLVVPKDLVGTFA
ACRDALDTCTAALPQLAMNDFIREGHFARHIRRMRVLYAERRAALVASIRTHLPEHLEVI
GAEAGMQLVALLPPDIDDIALSRRAAQVGVSARPLSPCYAEPPARGGLILGYGGADARAL
DEAVRRLKSCL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory