SitesBLAST
Comparing N515DRAFT_0974 FitnessBrowser__Dyella79:N515DRAFT_0974 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
26% identity, 80% coverage: 73:419/433 of query aligns to 63:425/446 of A0A0H2VG78
- R102 (= R120) mutation to A: Loss of transport activity.
- I105 (≠ M123) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E140) mutation to A: Loss of transport activity.
- Q137 (≠ S155) mutation to A: Loss of transport activity.
- Q250 (≠ T251) mutation to A: Loss of transport activity.
- Q251 (≠ Y252) mutation to A: Loss of transport activity.
- N256 (≠ T257) mutation to A: Loss of transport activity.
- W357 (≠ A347) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 22 D→N: Affects symport activity. May function as an uniporter.
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
26% identity, 46% coverage: 15:213/433 of query aligns to 42:251/583 of Q9Y7Q9
Sites not aligning to the query:
- 267 modified: Phosphoserine
- 269 modified: Phosphoserine
- 289 modified: Phosphoserine
- 290 modified: Phosphoserine
- 292 modified: Phosphoserine
- 330 modified: Phosphoserine
Q9Z2I6 Synaptic vesicle glycoprotein 2C; Synaptic vesicle protein 2C from Rattus norvegicus (Rat) (see 3 papers)
25% identity, 38% coverage: 59:221/433 of query aligns to 195:354/727 of Q9Z2I6
Sites not aligning to the query:
- 1:57 Interaction with SYT1
- 529:566 (Microbial infection) C.botulinum neurotoxin type A-binding
- 559 N→A: Loss of one glycosylation site. No effect on C.botulinum neurotoxin type A (BoNT/A, botA) binding, but reduces the uptake of BoNT/A.
Q496J9 Synaptic vesicle glycoprotein 2C from Homo sapiens (Human) (see 4 papers)
24% identity, 38% coverage: 59:221/433 of query aligns to 195:354/727 of Q496J9
Sites not aligning to the query:
- 519:563 (Microbial infection) C.botulinum neurotoxin type A-binding
- 534 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 559 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: No change in interaction with C.botulinum neurotoxin type A heavy chain (botA, BoNT/A HC). Decreased molecular weight probably due to glycosylation loss, decreased interaction with BoNT/A HC.; N→Q: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC. Greater reduction in weight; when associated with Q-565.
- 561 S→A: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC.
- 563 F→A: No longer interacts with BoNT/A HC.
- 565 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Decreased molecular weight probably due to glycosylation loss, no change in binding to BoNT/A heavy chain. Greater reduction in weight; when associated with Q-559.
Query Sequence
>N515DRAFT_0974 FitnessBrowser__Dyella79:N515DRAFT_0974
MTEKPGTPEISRGSMAVAALSTVVEWYDFTLYLYFATVLSRVFFGGGESSLLATLAGFAI
SYAMRPLGAVVFGHIGDRIGRRRTLLLSMMLMTLAMLATALLPSHAVAGPAAGALLLLLR
CFMAFSVGGEYTGVVAYLLEGARKDRRGLITSLASAASEIGALLAVGVSALTVSAMSTAQ
LDSWGWRIPFFVGAALAGCVWIARSTMEESPDFVRQVEQHTVPDSPLGHMLANHRPALFR
TFAISALGSITYYVGITYVPAFLSSSGILAEERSLWLSTLAAVAVILVTPLAGALSDRVG
RRPVLVWLAVASVLLPLAMFQLMARAMELNIALGAIVLACLAGGVSAVGAPATAEQFPGE
GRLSGLALGVTMATAIFGGLTPFLAELLIKMTGWHAVPGAMIGLVAIVVLPVLLAMPETN
PVVTKAWRWRSER
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory