SitesBLAST
Comparing N515DRAFT_0975 FitnessBrowser__Dyella79:N515DRAFT_0975 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
6k4eB Siaa-pp2c domain of pseudomonas aeruginosa (see paper)
28% identity, 32% coverage: 373:621/768 of query aligns to 1:245/246 of 6k4eB
3f79E Structure of pseudo-centered cell crystal form of thE C-terminal phosphatase domain of p. Aeruginosa rssb
27% identity, 25% coverage: 387:578/768 of query aligns to 13:202/236 of 3f79E
Q9HW91 Methyl-accepting chemotaxis protein PctB from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
20% identity, 34% coverage: 115:376/768 of query aligns to 95:360/629 of Q9HW91
- Y109 (≠ L126) binding
- S115 (≠ L132) binding ; binding
- Y121 (= Y138) binding ; binding
- RPW 126:128 (≠ QAW 141:143) binding ; binding
- YME 144:146 (≠ FFS 159:161) binding
- E146 (≠ S161) binding
- D173 (= D188) binding ; binding
Q9HW93 Methyl-accepting chemotaxis protein PctC from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
23% identity, 34% coverage: 115:376/768 of query aligns to 101:363/632 of Q9HW93
P9WLZ7 Multidomain regulatory protein Rv1364c; Anti-sigma-F factor Rv1364c; Anti-SigF factor; Protein-serine/threonine phosphatase; Putative multidomain regulator of SigF; MursiF; Serine/threonine-protein kinase; EC 3.1.3.16; EC 2.7.11.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 4 papers)
27% identity, 26% coverage: 487:683/768 of query aligns to 256:453/653 of P9WLZ7
- T299 (= T530) modified: Phosphothreonine; by PknD
- D328 (= D560) binding ; mutation to A: Leads to the accumulation of the autophosphorylated protein. 10-fold decrease in phosphatase activity.
- D387 (= D612) binding
- T390 (= T615) modified: Phosphothreonine; by PknD
- E444 (= E674) mutation to A: Strong decrease in ATPase activity. Abolishes autophosphorylation.; mutation to K: Abolishes autophosphorylation.
- N448 (= N678) mutation to A: Strong decrease in ATPase activity. Abolishes autophosphorylation.; mutation to K: Abolishes autophosphorylation.
- H452 (= H682) mutation to A: Abolishes autophosphorylation.
Sites not aligning to the query:
- 54 modified: Phosphothreonine; by PknD
- 81 modified: Phosphothreonine; by PknD
- 211 binding ; binding ; D→A: Does not affect autophosphorylation. 10-fold decrease in phosphatase activity.
- 212 binding
- 506 modified: Phosphoserine; by PknD
- 520 modified: Phosphothreonine; by PknD
- 568 modified: Phosphothreonine; by PknD
- 600 modified: Phosphoserine; by autocatalysis; S→A: Decreases ATPase activity. Abolishes autophosphorylation. Can still be phosphorylated by PknD.; S→E: Does not affect ATPase activity. Abolishes autophosphorylation.
3ke6A The crystal structure of the rsbu and rsbw domains of rv1364c from mycobacterium tuberculosis
28% identity, 28% coverage: 487:701/768 of query aligns to 96:301/354 of 3ke6A
Sites not aligning to the query:
B0R470 Transducer protein Htr4 from Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) (see paper)
33% identity, 15% coverage: 265:378/768 of query aligns to 268:376/778 of B0R470
Sites not aligning to the query:
- 522 modified: Glutamate methyl ester (Glu)
- 739 modified: Glutamate methyl ester (Glu)
Q88NI1 Methyl-accepting chemotaxis protein McpU from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
26% identity, 30% coverage: 143:370/768 of query aligns to 186:413/688 of Q88NI1
- W186 (= W143) mutation to A: Does not bind putrescine. 100-fold decrease in affinity for spermidine. 36-fold decrease in affinity for cadaverine.
- Y202 (≠ F159) mutation to A: Does not bind putrescine. 24-fold decrease in affinity for spermidine. 16-fold decrease in affinity for cadaverine.
- YLD 202:204 (≠ FFS 159:161) binding
- D204 (≠ S161) mutation to A: Does not bind putrescine and spermidine. 12-fold decrease in affinity for cadaverine.
- D233 (= D188) binding ; mutation to A: Does not bind putrescine, spermidine and cadaverine.
Sites not aligning to the query:
- 164 E→A: 20-fold decrease in affinity for putrescine. 7-fold decrease in affinity for spermidine. Increases affinity for cadaverine.
- 170 M→A: Does not bind putrescine. Does not affect affinity for spermidine. 3-fold decrease in affinity for cadaverine.
G3XD24 Methyl-accepting chemotaxis protein PctA from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 3 papers)
21% identity, 33% coverage: 123:376/768 of query aligns to 106:360/629 of G3XD24
- M111 (≠ V128) mutation to A: 120-fold reduction in AI-2 binding affinity.
- Y121 (= Y138) binding ; binding ; binding ; mutation to A: 150-fold reduction in AI-2 binding affinity.
- R126 (≠ Q141) mutation to A: Fails to recognize L-Ala, L-Arg, L-Thr, L-Trp and L-Pro. 290-fold reduction in AI-2 binding affinity.
- RPW 126:128 (≠ QAW 141:143) binding ; binding ; binding
- W128 (= W143) mutation to A: Fails to recognize L-Trp. Decreases affinity for L-Ala, L-Arg, L-Thr and L-Pro. 160-fold reduction in AI-2 binding affinity.
- Y144 (≠ F159) mutation to A: Binds L-Trp, but not L-Ala, L-Arg, L-Thr and L-Pro. 100-fold reduction in AI-2 binding affinity.
- YVDA 144:147 (≠ FFSQ 159:162) binding ; binding ; binding
- D146 (≠ S161) mutation to A: Fails to recognize L-Ala, L-Arg, L-Thr, L-Trp and L-Pro. 240-fold reduction in AI-2 binding affinity.
- A147 (≠ Q162) mutation to F: 80-fold reduction in AI-2 binding affinity.
- D173 (= D188) binding ; binding ; binding ; mutation to A: Binds L-Trp, but not L-Ala, L-Arg, L-Thr and L-Pro. 85-fold reduction in AI-2 binding affinity.
Sites not aligning to the query:
- 101 Y→A: 260-fold reduction in AI-2 binding affinity.
P39215 Methyl-accepting chemotaxis protein McpB; H3 from Bacillus subtilis (strain 168) (see 2 papers)
19% identity, 30% coverage: 137:363/768 of query aligns to 139:351/662 of P39215
Sites not aligning to the query:
- 371 modified: Glutamate methyl ester (Gln); Q→D: Marked diminution of methanol upon both addition and removal of asparagine. No release of methanol upon asparagine addition but methanol release upon asparagine removal is not affected; when associated with D-630. Release of methanol upon both asparagine addition and removal; when associated with D-637. No methylation; when associated with D-630 and D-637.
- 595 Q→D: Wild-type production of methanol.
- 630 modified: Glutamate methyl ester (Glu); E→D: Marked diminution of methanol upon both addition and removal of asparagine; methanol release delayed by about 1 minute compared to wild-type; adapts normally to addition of asparagine but fails to adapt to asparagine removal. No release of methanol upon asparagine addition but methanol release upon asparagine removal is not affected; when associated with D-371. Releases methanol upon asparagine addition but not upon asparagine removal; when associated with D-637. No methylation; when associated with D-371 and D-637.
- 637 modified: Glutamate methyl ester (Glu); E→D: Marked diminution of methanol upon both addition and removal of asparagine; fails to adapt to addition of asparagine. Release of methanol upon both asparagine addition and removal; when associated with D-371. Releases methanol upon asparagine addition but not upon asparagine removal; when associated with D-630. No methylation; when associated with D-371 and D-630.
Query Sequence
>N515DRAFT_0975 FitnessBrowser__Dyella79:N515DRAFT_0975
MVLRSIASRLAVWVLAGTLLVVVAGGLLLFRVVRQQILEQTHRESAVLAGDVSHRIQHRL
DKVADTAQMLAALIGPRPDDAEPLIRDALAHNADLDGLAAAYVPASIDARAPVRSPFVSR
HLDGSLSVRDLLKDPAPYWTQAWFATGLACATGCWQQPFFSQSRQRRLVNYSAAIEAGGR
PVGVLNADVTLEWLQGVLQALNKPRDTEAFVIDQQGVYLAVEGSALAGQRAQDELIAALR
GDPAEPIRHTGLLATHANAPVWIYHAPIDGTHWQFGLVVPEERIYGGVRRTFSVALSVGA
LALLSLTLLTLVVTRRVLSPLGVLTERAEQVAKGALDFELPRVRRRDEVGRLTHAFDRMR
HELADHLAELGRVAREQQRLASELEIAQQIQTALLPGAHFLDARCNNFELHAVLKPARTV
GGDLYSYFMLHDQRFYIMVGDVSDKGIPAALFMARAITLAKALAPRAQSPQQLLQLLNQE
LCRNNDGCMFVSLLCGLLDTATGHFSMASAGHEPPVLWGEGAPQLLEIETGPALGLDDEA
TYSSRRVRLRPGETLLMYTDGITEATDAELRMYGPERMLDCLGRYAAHGDGDPAGYLLAD
VEAFAAGHGQADDITVLALRWHHAGADGGASMLELTMPASIEAVFDALARCEEQLAAAGV
AQGVRGDVRLVLEELMVNMAEHGRPHTGAARIELRMTLATDAVLVDLHHDGVPFNPLLSP
EPLLTGDVADREIDGGLGIHLVRAMASDFSYAHDEEGNHLQLRFILPT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory