SitesBLAST
Comparing N515DRAFT_1006 FitnessBrowser__Dyella79:N515DRAFT_1006 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
72% identity, 99% coverage: 1:246/248 of query aligns to 6:251/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G13), S20 (= S15), K21 (= K16), G22 (= G17), I23 (= I18), A43 (= A38), S44 (= S39), S45 (= S40), G68 (= G63), D69 (= D64), V70 (= V65), N96 (= N91), S97 (= S92), G98 (= G93), Y100 (= Y95), I144 (= I139), S146 (= S141), Y159 (= Y154), K163 (= K158), P189 (= P184), G190 (= G185), M191 (= M186), I192 (≠ V187), T194 (= T189), G196 (= G191), T197 (= T192)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S141), Y159 (= Y154), M191 (= M186), I202 (≠ F197)
8hfkA Crystal structure of cbar mutant (h162f) in complex with NADP+ and halogenated aryl ketone (see paper)
42% identity, 99% coverage: 3:247/248 of query aligns to 5:258/259 of 8hfkA
- binding 2-bromanyl-1-(4-bromanyl-2-oxidanyl-phenyl)ethanone: S143 (= S141), N144 (≠ L142), T145 (≠ V143), F153 (≠ G151), Y156 (= Y154), G187 (= G185), M193 (≠ G196), V197 (≠ S200)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), R18 (≠ K16), I20 (= I18), A40 (= A38), N41 (≠ S39), S42 (= S40), D66 (= D64), N93 (= N91), S94 (= S92), L116 (≠ V114), T141 (≠ I139), Y156 (= Y154), K160 (= K158), P186 (= P184), G187 (= G185), G188 (= G191), T189 (= T192), T191 (= T194), M193 (≠ G196)
Sites not aligning to the query:
5wuwA Serratia marcescens short-chain dehydrogenase/reductase f98l/f202l mutant (see paper)
44% identity, 98% coverage: 4:246/248 of query aligns to 3:242/245 of 5wuwA
- active site: G16 (= G17), S140 (= S141), Y154 (= Y154), L161 (≠ V161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), R15 (≠ K16), I17 (= I18), Y36 (= Y37), A37 (= A38), A38 (≠ S39), D63 (= D64), S64 (≠ V65), N90 (= N91), A91 (≠ S92), G92 (= G93), Y154 (= Y154), K158 (= K158), G185 (= G185), P186 (≠ M186), V187 (= V187)
7yb2D Crystal structure of anthrol reductase (cbar) in complex with NADP+ and emodin (see paper)
42% identity, 99% coverage: 3:247/248 of query aligns to 9:263/264 of 7yb2D
- binding 3-methyl-1,6,8-trihydroxyanthraquinone: S147 (= S141), Y161 (= Y154), G193 (= G191), M198 (≠ G196), F199 (= F197), V202 (≠ S200), S203 (≠ D201), Y206 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G13), R22 (≠ K16), G23 (= G17), I24 (= I18), Y43 (= Y37), A44 (= A38), N45 (≠ S39), S46 (= S40), D70 (= D64), V71 (= V65), N97 (= N91), S98 (= S92), L120 (≠ V114), T145 (≠ I139), S147 (= S141), Y161 (= Y154), K165 (= K158), P191 (= P184), G192 (= G185), T194 (= T192), T196 (= T194), M198 (≠ G196)
8hfjC Crystal structure of cbar mutant (h162f) in complex with NADP+ and a bulky 1,3-cyclodiketone (see paper)
42% identity, 99% coverage: 3:247/248 of query aligns to 5:259/260 of 8hfjC
- binding 2-methyl-2-[(4-methylphenyl)methyl]cyclopentane-1,3-dione: N144 (≠ L142), T145 (≠ V143), F154 (≠ G151), G189 (= G191), V198 (≠ S200)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), R18 (≠ K16), I20 (= I18), Y39 (= Y37), A40 (= A38), N41 (≠ S39), S42 (= S40), D66 (= D64), V67 (= V65), N93 (= N91), S94 (= S92), L116 (≠ V114), T141 (≠ I139), Y157 (= Y154), K161 (= K158), P187 (= P184), T190 (= T192), T192 (= T194), M194 (≠ G196)
Sites not aligning to the query:
4fj0D Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and 3,7-dihydroxy flavone (see paper)
40% identity, 99% coverage: 3:247/248 of query aligns to 6:260/261 of 4fj0D
- active site: G20 (= G17), S144 (= S141), N145 (≠ L142), H155 (≠ G151), Y158 (= Y154), K162 (= K158), Y203 (vs. gap)
- binding 3,7-dihydroxy-2-phenyl-4H-chromen-4-one: S144 (= S141), N145 (≠ L142), G190 (= G191), F196 (= F197), S200 (≠ D201), Y203 (vs. gap), A219 (≠ I207)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G13), R19 (≠ K16), G20 (= G17), I21 (= I18), A41 (= A38), N42 (≠ S39), S43 (= S40), I68 (≠ V65), N94 (= N91), S95 (= S92), G96 (= G93), L117 (≠ V114), T142 (≠ I139), Y158 (= Y154), K162 (= K158), P188 (= P184), G189 (= G185), G190 (= G191), T191 (= T192), T193 (= T194), M195 (≠ G196)
4fj2B Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and biochanin a (see paper)
40% identity, 99% coverage: 3:247/248 of query aligns to 5:259/260 of 4fj2B
- active site: G19 (= G17), S143 (= S141), N144 (≠ L142), H154 (≠ G151), Y157 (= Y154), K161 (= K158), Y202 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), R18 (≠ K16), G19 (= G17), I20 (= I18), A40 (= A38), N41 (≠ S39), S42 (= S40), I67 (≠ V65), N93 (= N91), S94 (= S92), G95 (= G93), L116 (≠ V114), T141 (≠ I139), Y157 (= Y154), K161 (= K158), G188 (= G185), G189 (= G191), T190 (= T192), T192 (= T194), M194 (≠ G196)
- binding 5,7-dihydroxy-3-(4-methoxyphenyl)-4H-chromen-4-one: G189 (= G191), F195 (= F197), V198 (≠ S200), S199 (≠ D201), Y202 (vs. gap), I203 (vs. gap), M217 (≠ A206), A218 (≠ I207)
3qwiA Crystal structure of a 17beta-hydroxysteroid dehydrogenase (holo form) from fungus cochliobolus lunatus in complex with NADPH and coumestrol (see paper)
40% identity, 99% coverage: 3:247/248 of query aligns to 5:259/260 of 3qwiA
- active site: G19 (= G17), S143 (= S141), N144 (≠ L142), H154 (≠ G151), Y157 (= Y154), K161 (= K158), Y202 (vs. gap)
- binding Coumestrol: F149 (≠ I146), G189 (= G191), M194 (≠ G196), Y202 (vs. gap), I203 (vs. gap), A218 (≠ I207)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), R18 (≠ K16), I20 (= I18), A40 (= A38), N41 (≠ S39), S42 (= S40), I67 (≠ V65), N93 (= N91), S94 (= S92), G95 (= G93), L116 (≠ V114), T141 (≠ I139), Y157 (= Y154), K161 (= K158), P187 (= P184), G188 (= G185), G189 (= G191), T190 (= T192), T192 (= T194), M194 (≠ G196)
3qwhA Crystal structure of the 17beta-hydroxysteroid dehydrogenase from cochliobolus lunatus in complex with NADPH and kaempferol (see paper)
40% identity, 99% coverage: 3:247/248 of query aligns to 5:259/260 of 3qwhA
- active site: G19 (= G17), S143 (= S141), N144 (≠ L142), H154 (≠ G151), Y157 (= Y154), K161 (= K158), Y202 (vs. gap)
- binding 3,5,7-trihydroxy-2-(4-hydroxyphenyl)-4h-chromen-4-one: N144 (≠ L142), F149 (≠ I146), G189 (= G191), F195 (= F197), S199 (≠ D201), Y202 (vs. gap), I203 (vs. gap), A218 (≠ I207)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), R18 (≠ K16), G19 (= G17), I20 (= I18), A40 (= A38), N41 (≠ S39), S42 (= S40), D66 (= D64), I67 (≠ V65), N93 (= N91), S94 (= S92), G95 (= G93), L116 (≠ V114), T141 (≠ I139), Y157 (= Y154), K161 (= K158), P187 (= P184), G188 (= G185), G189 (= G191), T190 (= T192), T192 (= T194), M194 (≠ G196)
4fj1B Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and genistein (see paper)
40% identity, 99% coverage: 3:247/248 of query aligns to 4:258/259 of 4fj1B
- active site: G18 (= G17), S142 (= S141), N143 (≠ L142), H153 (≠ G151), Y156 (= Y154), K160 (= K158), Y201 (vs. gap)
- binding genistein: G188 (= G191), F194 (= F197), S198 (≠ D201), Y201 (vs. gap), I202 (vs. gap), M216 (≠ A206), A217 (≠ I207)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G13), R17 (≠ K16), G18 (= G17), I19 (= I18), A39 (= A38), N40 (≠ S39), S41 (= S40), I66 (≠ V65), N92 (= N91), S93 (= S92), G94 (= G93), L115 (≠ V114), T140 (≠ I139), S142 (= S141), Y156 (= Y154), K160 (= K158), G187 (= G185), T189 (= T192), T191 (= T194), M193 (≠ G196)
1g0nA Structure of trihydroxynaphthalene reductase in complex with NADPH and 4,5,6,7-tetrachloro-phthalide (see paper)
38% identity, 98% coverage: 4:247/248 of query aligns to 17:271/273 of 1g0nA
- active site: G30 (= G17), S154 (= S141), H165 (≠ G151), Y168 (= Y154), K172 (= K158)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G26 (= G13), R29 (≠ K16), G30 (= G17), I31 (= I18), A51 (= A38), N52 (≠ S39), S53 (= S40), V78 (= V65), N104 (= N91), S105 (= S92), G106 (= G93), I127 (≠ V114), M152 (≠ I139), Y168 (= Y154), K172 (= K158), P198 (= P184), G200 (≠ M186), I201 (≠ V187), T203 (= T189), M205 (vs. gap)
- binding 4,5,6,7-tetrachloro-phthalide: S154 (= S141), Y168 (= Y154), G200 (≠ M186), M205 (vs. gap), Y206 (vs. gap), C210 (≠ T194), Y213 (≠ F197), W233 (≠ H209)
1dohA Structure of trihydroxynaphthalene reductase in complex with NADPH and 4-nitro-inden-1-one (see paper)
38% identity, 98% coverage: 4:247/248 of query aligns to 17:271/273 of 1dohA
- active site: G30 (= G17), S154 (= S141), H165 (≠ G151), Y168 (= Y154), K172 (= K158), Y213 (≠ F197)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G26 (= G13), R29 (≠ K16), G30 (= G17), I31 (= I18), A51 (= A38), N52 (≠ S39), S53 (= S40), N77 (≠ D64), V78 (= V65), N104 (= N91), S105 (= S92), G106 (= G93), M152 (≠ I139), Y168 (= Y154), K172 (= K158), P198 (= P184), G200 (≠ M186), I201 (≠ V187), T203 (= T189), M205 (vs. gap)
- binding 4-nitro-inden-1-one: Y168 (= Y154), G200 (≠ M186), Y206 (vs. gap), C210 (≠ T194), Y213 (≠ F197)
1g0oC Structure of trihydroxynaphthalene reductase in complex with NADPH and pyroquilon (see paper)
38% identity, 98% coverage: 4:247/248 of query aligns to 25:279/281 of 1g0oC
- active site: G38 (= G17), S162 (= S141), H173 (≠ G151), Y176 (= Y154), K180 (= K158), Y221 (≠ F197)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G34 (= G13), R37 (≠ K16), G38 (= G17), I39 (= I18), A59 (= A38), N60 (≠ S39), S61 (= S40), N85 (≠ D64), V86 (= V65), N112 (= N91), S113 (= S92), G114 (= G93), M160 (≠ I139), Y176 (= Y154), K180 (= K158), P206 (= P184), G208 (≠ M186), I209 (≠ V187), T211 (= T189), M213 (vs. gap)
- binding pyroquilon: S162 (= S141), I163 (≠ L142), Y176 (= Y154), G208 (≠ M186), Y221 (≠ F197)
1ybvA Structure of trihydroxynaphthalene reductase in complex with NADPH and an active site inhibitor (see paper)
38% identity, 99% coverage: 2:247/248 of query aligns to 12:268/270 of 1ybvA
- active site: G27 (= G17), S151 (= S141), H162 (≠ G151), Y165 (= Y154), K169 (= K158), Y210 (≠ F197)
- binding 5-methyl-1,2,4-triazolo[3,4-b]benzothiazole: S151 (= S141), Y165 (= Y154), G197 (≠ M186), M202 (vs. gap), Y203 (vs. gap), Y210 (≠ F197), W230 (≠ H209)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G23 (= G13), R26 (≠ K16), G27 (= G17), I28 (= I18), A48 (= A38), N49 (≠ S39), S50 (= S40), N74 (≠ D64), V75 (= V65), N101 (= N91), S102 (= S92), G103 (= G93), M149 (≠ I139), S151 (= S141), K169 (= K158), P195 (= P184), G197 (≠ M186), I198 (≠ V187), T200 (= T189), M202 (vs. gap)
Q12634 Tetrahydroxynaphthalene reductase; T4HN reductase; THNR; EC 1.1.1.252 from Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Magnaporthe oryzae) (see 2 papers)
38% identity, 99% coverage: 2:247/248 of query aligns to 25:281/283 of Q12634
- 39:63 (vs. 16:40, 48% identical) binding
- Y178 (= Y154) active site, Proton acceptor
P40288 Glucose 1-dehydrogenase; EC 1.1.1.47 from Priestia megaterium (Bacillus megaterium) (see 2 papers)
36% identity, 98% coverage: 4:246/248 of query aligns to 5:249/261 of P40288
- 11:35 (vs. 10:34, 44% identical) binding
- E96 (≠ Y95) mutation E->A,G,K: Heat stable.
- D108 (≠ H107) mutation to N: Heat stable.
- V112 (≠ Q111) mutation to A: Heat stable.
- E133 (= E132) mutation to K: Heat stable.
- V183 (= V179) mutation to I: Heat stable.
- P194 (≠ E190) mutation to Q: Heat stable.
- E210 (≠ I207) mutation to K: Heat stable.
- Y217 (≠ R214) mutation to H: Heat stable.
Sites not aligning to the query:
- 252 Q→L: Heat stable.
- 253 Y→C: Heat stable.
- 258 A→G: Heat stable.
1g6kA Crystal structure of glucose dehydrogenase mutant e96a complexed with NAD+
36% identity, 98% coverage: 4:246/248 of query aligns to 5:249/261 of 1g6kA
- active site: G18 (= G17), S145 (= S141), Y158 (= Y154), K162 (= K158)
- binding nicotinamide-adenine-dinucleotide: T17 (≠ K16), G18 (= G17), L19 (≠ I18), R39 (≠ A38), D65 (= D64), V66 (= V65), N92 (= N91), A93 (≠ S92), G94 (= G93), M143 (≠ I139), S145 (= S141), Y158 (= Y154), P188 (= P184), G189 (= G185), I191 (≠ V187), T193 (= T189)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
40% identity, 98% coverage: 4:246/248 of query aligns to 3:244/247 of 4jroC
- active site: G16 (= G17), S142 (= S141), Q152 (≠ G151), Y155 (= Y154), K159 (= K158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (= S15), R15 (≠ K16), G16 (= G17), I17 (= I18), N35 (= N36), Y36 (= Y37), N37 (≠ A38), G38 (≠ S39), S39 (= S40), N63 (≠ D64), V64 (= V65), N90 (= N91), A91 (≠ S92), I93 (≠ V94), I113 (≠ V114), S142 (= S141), Y155 (= Y154), K159 (= K158), P185 (= P184), I188 (≠ V187), T190 (= T189)
8bcjB Crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 in complex with NADP+
39% identity, 97% coverage: 7:246/248 of query aligns to 5:249/250 of 8bcjB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G13), S13 (= S15), R14 (≠ K16), G15 (= G17), I16 (= I18), L36 (≠ A38), R37 (≠ S39), N38 (≠ S40), A61 (≠ G63), D62 (= D64), V63 (= V65), N89 (= N91), A90 (≠ S92), G91 (= G93), T113 (≠ V114), V143 (≠ I139), S145 (= S141), Y159 (= Y154), K163 (= K158), P189 (= P184), G190 (= G185), I192 (≠ V187), T194 (= T189), I196 (≠ G191), H197 (≠ T192)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
39% identity, 97% coverage: 7:246/248 of query aligns to 5:243/246 of 3osuA
Query Sequence
>N515DRAFT_1006 FitnessBrowser__Dyella79:N515DRAFT_1006
MSKLKGKVALVTGASKGIGAGIAKALAAEGAAVVVNYASSKAGADAVVDAITKAGGKAVA
VKGDVAQAADAQAIADAAVKEFGRLDILVNNSGVYEFAPLEQITEDHFHKQFNVNVLGLL
LTTQAAAKHMGEGGSIINIGSLVTRIVPPGGSVYTATKGAVDAITGVLSRELGPRKIRVN
ALNPGMVETEGTVTAGFIGSDFHQEAIAHTPLGRIGQPQDIATIAVFLASDDSYWLTGEK
LYAAGGAR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory