SitesBLAST
Comparing N515DRAFT_1074 FitnessBrowser__Dyella79:N515DRAFT_1074 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3pduA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with NADP+ (see paper)
33% identity, 95% coverage: 4:280/292 of query aligns to 5:281/287 of 3pduA
- binding glycerol: R242 (≠ N241), E246 (≠ S245), E246 (≠ S245), R250 (≠ A249)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), G10 (= G9), I11 (≠ A10), M12 (= M11), N31 (= N30), R32 (= R31), N33 (≠ S32), M64 (= M62), L65 (= L63), A66 (≠ S64), A70 (= A68), T96 (= T93), V121 (= V118), G123 (= G120), T124 (≠ R121), K171 (= K169), S231 (≠ G230), F232 (= F231), P233 (≠ A232), H236 (≠ L235), K239 (= K238)
3pefA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with NADP+ (see paper)
35% identity, 96% coverage: 2:280/292 of query aligns to 3:281/287 of 3pefA
- binding glycerol: D67 (≠ N65), G123 (= G120), K171 (= K169), N175 (= N173), M178 (≠ L176), L203 (= L201), G207 (≠ T205), N213 (≠ A211), A217 (≠ Q215), F232 (= F231), H236 (≠ L235), K239 (= K238), R242 (≠ N241), R269 (≠ L268)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G9), I11 (≠ A10), M12 (= M11), N31 (= N30), R32 (= R31), S33 (= S32), K36 (≠ A35), M64 (= M62), L65 (= L63), A66 (≠ S64), A70 (= A68), E73 (= E71), T96 (= T93), V121 (= V118), G123 (= G120), S124 (≠ R121), A231 (= A229), F232 (= F231), H236 (≠ L235), K239 (= K238)
2uyyA Structure of the cytokine-like nuclear factor n-pac
32% identity, 96% coverage: 2:280/292 of query aligns to 8:286/292 of 2uyyA
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4s)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: G15 (= G9), L16 (≠ A10), M17 (= M11), N36 (= N30), R37 (= R31), T38 (≠ S32), V70 (≠ L63), S71 (= S64), A75 (= A68), T101 (= T93), F237 (= F231), Y238 (≠ A232), Y241 (≠ L235), K244 (= K238)
Q49A26 Cytokine-like nuclear factor N-PAC; NPAC; 3-hydroxyisobutyrate dehydrogenase-like protein; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Nuclear protein of 60 kDa; Nucleosome-destabilizing factor; hNDF; Putative oxidoreductase GLYR1 from Homo sapiens (Human) (see 3 papers)
32% identity, 96% coverage: 2:280/292 of query aligns to 269:547/553 of Q49A26
- 271:285 (vs. 4:18, 67% identical) binding
- T362 (= T93) binding
- M437 (≠ V168) mutation to K: Loss of tetramerization and protein stability.; mutation to N: No effect on tetramerization or protein stability.
- P496 (= P228) to L: decreased interaction with GATA4; decreased synergistic activation of GATA4 target genes transcription; detrimental effect on cardiomyocyte differentiation
- K505 (= K238) binding
Sites not aligning to the query:
- 214 D→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 214:217 Interaction with histone H3
- 216 H→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 216:225 Interaction with KDM1B
- 217 Required to promote KDM1B demethylase activity toward histone H3K4me1 and H3K4me2; F→A: Abolished stimulation of KDM1B demethylase activity, reduced affinity for histone H3 of the dimer with KDM1B, but normal KDM1B-binding.
- 219 H→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-223.
- 220:222 FLL→AAA: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity.
- 223 S→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-219.
Q922P9 Cytokine-like nuclear factor N-PAC; NPAC; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Putative oxidoreductase GLYR1 from Mus musculus (Mouse) (see paper)
32% identity, 96% coverage: 2:280/292 of query aligns to 268:540/546 of Q922P9
- P489 (= P228) mutation to L: Mutant animals are born at expected Mendelian ratios. 54% mutants display postnatal lethality between days 0 and 1. They show centricular septal defects.
5je8B The crystal structure of bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with NAD (see paper)
28% identity, 96% coverage: 2:280/292 of query aligns to 5:285/294 of 5je8B
3ws7A The 1.18 a resolution structure of l-serine 3-dehydrogenase complexed with NADP+ and sulfate ion from the hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
34% identity, 89% coverage: 1:259/292 of query aligns to 14:269/293 of 3ws7A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G7), L21 (= L8), G22 (= G9), I23 (≠ A10), M24 (= M11), N43 (= N30), R44 (= R31), T45 (≠ S32), K48 (≠ A35), M76 (= M62), V77 (≠ L63), S78 (= S64), D82 (≠ A68), Q85 (≠ E71), V133 (= V118), F241 (= F231), K242 (≠ A232), H245 (≠ L235), K248 (= K238)
- binding sulfate ion: T134 (≠ F119), G135 (= G120), K183 (= K169)
3w6zA Crystal structure of NADP bound l-serine 3-dehydrogenase (k170m) from hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
32% identity, 89% coverage: 1:259/292 of query aligns to 14:272/296 of 3w6zA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G7), L21 (= L8), G22 (= G9), I23 (≠ A10), M24 (= M11), N43 (= N30), R44 (= R31), T45 (≠ S32), K48 (≠ A35), V77 (≠ L63), S78 (= S64), D82 (≠ A68), Q85 (≠ E71), V133 (= V118), F244 (= F231), K245 (≠ A232), H248 (≠ L235), K251 (= K238)
6smzC Crystal structure of sla reductase yihu from e. Coli in complex with nadh
30% identity, 95% coverage: 3:280/292 of query aligns to 3:281/295 of 6smzC
- binding nicotinamide-adenine-dinucleotide: G9 (= G9), Q10 (≠ A10), M11 (= M11), F29 (≠ W29), D30 (≠ N30), V31 (≠ R31), M63 (= M62), L64 (= L63), V73 (= V72), S94 (≠ A92), T95 (= T93), R122 (≠ G120)
P0A9V8 3-sulfolactaldehyde reductase; SLA reductase; 4-hydroxybutyrate dehydrogenase; Gamma-hydroxybutyrate dehydrogenase; GHBDH; Succinic semialdehyde reductase; SSA reductase; EC 1.1.1.373; EC 1.1.1.61 from Escherichia coli (strain K12)
30% identity, 95% coverage: 3:280/292 of query aligns to 4:282/298 of P0A9V8
- QM 11:12 (≠ AM 10:11) binding
- D31 (≠ N30) binding
- L65 (= L63) binding
- T96 (= T93) binding
- G122 (≠ F119) mutation to S: 25-fold decrease in catalytic efficiency with SLA as substrate. 5-fold decrease in catalytic efficiency with NADH as substrate.
- R123 (≠ G120) binding ; mutation to G: 130-fold decrease in catalytic efficiency with SLA as substrate. 3-fold decrease in catalytic efficiency with NADH as substrate.
- T124 (≠ R121) mutation to G: 230-fold decrease in catalytic efficiency with SLA as substrate. 12-fold decrease in catalytic efficiency with NADH as substrate.
- NNYMS 174:178 (≠ GNFML 172:176) binding
- K240 (= K238) binding
6smyA Crystal structure of sla reductase yihu from e. Coli with nadh and product dhps
30% identity, 95% coverage: 3:280/292 of query aligns to 3:281/294 of 6smyA
Q8T079 Cytokine-like nuclear factor N-PAC; NPAC; Glyoxylate reductase 1 homolog; Nuclear protein NP60 homolog; Nucleosome-destabilizing factor; Putative oxidoreductase GLYR1 homolog from Drosophila melanogaster (Fruit fly) (see paper)
27% identity, 95% coverage: 4:280/292 of query aligns to 319:596/602 of Q8T079
Sites not aligning to the query:
- 8 modified: Phosphoserine
- 10 modified: Phosphoserine
- 224 modified: Phosphoserine
- 228 modified: Phosphoserine
- 243 modified: Phosphoserine
3q3cA Crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with NAD (see paper)
36% identity, 88% coverage: 2:258/292 of query aligns to 2:264/294 of 3q3cA
- binding nicotinamide-adenine-dinucleotide: G9 (= G9), H10 (≠ A10), M11 (= M11), F29 (≠ W29), D30 (≠ N30), L31 (≠ R31), M63 (= M62), L64 (= L63), P65 (≠ S64), T94 (= T93), V119 (= V118), G121 (= G120), F237 (= F231), K244 (= K238)
P29266 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Rattus norvegicus (Rat) (see paper)
27% identity, 95% coverage: 3:280/292 of query aligns to 41:325/335 of P29266
- D68 (≠ N30) mutation to R: Decrease of activity with NAD, increase of activity with NADP.
- K208 (= K169) mutation K->A,H,N,R: Complete loss of activity.
- N212 (= N173) mutation to Q: Decrease in activity.
2i9pB Crystal structure of human hydroxyisobutyrate dehydrogenase complexed with NAD+
27% identity, 96% coverage: 1:280/292 of query aligns to 1:287/296 of 2i9pB
- binding nicotinamide-adenine-dinucleotide: G9 (= G9), N10 (≠ A10), M11 (= M11), Y29 (≠ W29), D30 (≠ N30), V31 (≠ R31), M63 (= M62), L64 (= L63), P65 (vs. gap), T95 (= T93), V120 (= V118), G122 (= G120), F238 (= F231), K245 (= K238)
Q9I5I6 NAD-dependent L-serine dehydrogenase; L-serine 3-dehydrogenase (NAD(+)); EC 1.1.1.387 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
35% identity, 88% coverage: 2:258/292 of query aligns to 3:266/298 of Q9I5I6
- P66 (≠ S64) binding
- T96 (= T93) binding ; mutation to A: Almost abolished activity.
- S122 (≠ F119) mutation to A: Strongly reduced activity.
- K171 (= K169) active site
- N175 (= N173) mutation to A: Strongly reduced activity.
- W214 (vs. gap) mutation to A: Almost abolished activity.
- Y219 (≠ A211) mutation to A: Strongly reduced activity.
- K246 (= K238) binding ; mutation to A: Almost abolished activity.
- D247 (= D239) mutation to A: Almost abolished activity.
Sites not aligning to the query:
P31937 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Homo sapiens (Human) (see paper)
27% identity, 95% coverage: 3:280/292 of query aligns to 42:326/336 of P31937
- LP 103:104 (≠ L- 63) binding
- N108 (≠ Q67) binding
- T134 (= T93) binding
- K284 (= K238) binding
Sites not aligning to the query:
- 1:36 modified: transit peptide, Mitochondrion
- 40:68 binding
5y8iA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + (s)-3-hydroxyisobutyrate (s-hiba) (see paper)
31% identity, 95% coverage: 3:280/292 of query aligns to 3:283/292 of 5y8iA
5y8hA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + NAD+ (see paper)
31% identity, 95% coverage: 3:280/292 of query aligns to 3:283/291 of 5y8hA
- binding (2~{S})-2-methylpentanedioic acid: R144 (= R145), E148 (= E149), A151 (≠ G152), K153 (≠ A154)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G9 (= G9), N10 (≠ A10), M11 (= M11), F29 (≠ W29), D30 (≠ N30), P31 (≠ R31), M63 (= M62), L64 (= L63), G120 (≠ R121), L239 (= L235), K242 (= K238)
5y8lB Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + NAD +(s)-3-hydroxyisobutyrate (s-hiba) (see paper)
31% identity, 95% coverage: 3:280/292 of query aligns to 4:284/290 of 5y8lB
- binding (2~{S})-2-methylpentanedioic acid: T129 (≠ R129), E149 (= E149), A152 (≠ G152), G153 (≠ S153), G153 (≠ S153), K154 (≠ A154)
- binding (2S)-2-methyl-3-oxidanyl-propanoic acid: S119 (≠ F119), G120 (= G120), W211 (vs. gap), F236 (= F231)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G10 (= G9), N11 (≠ A10), M12 (= M11), F30 (≠ W29), D31 (≠ N30), P32 (≠ R31), M64 (= M62), L65 (= L63), T93 (= T93), G121 (≠ R121), K168 (= K169), L240 (= L235), K243 (= K238)
Query Sequence
>N515DRAFT_1074 FitnessBrowser__Dyella79:N515DRAFT_1074
MKVGFIGLGAMGSAMASNLLKAGHSVTVWNRSPEATAPLASLGAKVASTPQRAAQGEALF
SMLSNDQAVREVVLDSGLLEEMDKGTVHVNHATVSVALARELASAHAQRGLDYVAAPVFG
RPDVAAAGRLNIVVAGKPAVLERVRPLLEAMGSAIWPMGEEAERANVVKIAGNFMLGAAI
ESMAEASALTRAHGVSAGDFLHVMTSTLFAAPPYQGYAKLIAEQRFKPAGFALPLGYKDI
NLALSAADATRVPLPFASVLRDSLLETLALGDEDVDWSALAMVAARRAGLKD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory