SitesBLAST
Comparing N515DRAFT_1080 FitnessBrowser__Dyella79:N515DRAFT_1080 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
35% identity, 96% coverage: 1:407/422 of query aligns to 1:423/425 of O59010
- S65 (≠ A60) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ S264) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ SSS 264:266) binding
- M311 (= M300) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (≠ C303) binding
- V355 (= V345) binding
- D394 (= D378) binding
- M395 (= M379) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R381) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N385) binding
- D405 (≠ Q389) mutation to N: Strongly decreased affinity for aspartate.
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
35% identity, 92% coverage: 14:401/422 of query aligns to 6:409/409 of 6bavA
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
35% identity, 95% coverage: 1:403/422 of query aligns to 1:419/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: Y4 (≠ V4), Y7 (≠ W7), F46 (≠ L41), F46 (≠ L41), P75 (≠ V71), L91 (= L87), F95 (≠ L91), L130 (≠ A126), I133 (≠ V129), I159 (≠ G155), Y167 (vs. gap), K196 (≠ Q184), G200 (≠ F188), I207 (= I195), F210 (= F198), L250 (= L238), I262 (≠ F250), M269 (= M257), T334 (≠ E324), V335 (≠ P325), G336 (≠ A326), T340 (≠ V330), L343 (= L333), M399 (= M383)
- binding aspartic acid: S277 (= S265), S278 (= S266), T314 (≠ C303), G354 (= G344), A358 (≠ T348), G359 (≠ A349), D394 (= D378), R397 (= R381), T398 (= T382)
- binding sodium ion: Y89 (≠ F85), T92 (= T88), S93 (≠ A89), G306 (= G295), T308 (≠ S297), N310 (≠ K299), N310 (≠ K299), M311 (= M300), D312 (= D301), S349 (= S339), I350 (≠ F340), T352 (= T342), N401 (= N385), V402 (= V386), D405 (≠ Q389)
2nwwA Crystal structure of gltph in complex with tboa (see paper)
35% identity, 92% coverage: 14:400/422 of query aligns to 5:407/407 of 2nwwA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
35% identity, 92% coverage: 14:400/422 of query aligns to 6:408/408 of 6bauA
- binding cysteine: S270 (= S266), M303 (= M300), T306 (≠ C303), A345 (= A343), G346 (= G344), V347 (= V345), G351 (≠ A349), D386 (= D378), C389 (≠ R381), T390 (= T382), N393 (= N385)
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
35% identity, 92% coverage: 14:400/422 of query aligns to 11:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (≠ S64), V83 (≠ F82), I157 (≠ L156), Y164 (vs. gap), K193 (≠ Q184), T305 (≠ S297), I306 (= I298), I347 (≠ F340)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (≠ V16), M199 (≠ L190), S275 (= S266), T311 (≠ C303), G356 (≠ A349), L384 (≠ V371), D391 (= D378), R394 (= R381)
Sites not aligning to the query:
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
37% identity, 93% coverage: 12:404/422 of query aligns to 11:420/426 of 6xwnB
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
37% identity, 93% coverage: 12:404/422 of query aligns to 11:420/427 of 5e9sA
- binding aspartic acid: R274 (≠ S264), S275 (= S265), S276 (= S266), T313 (≠ C303), G353 (= G344), V354 (= V345), A357 (≠ T348), G358 (≠ A349), D394 (= D378), R397 (= R381), T398 (= T382)
- binding decyl-beta-d-maltopyranoside: L194 (≠ Q184), G198 (≠ F188), Y202 (≠ M192)
- binding sodium ion: Y87 (≠ F85), T90 (= T88), S91 (≠ A89), S276 (= S266), G305 (= G295), A306 (= A296), T307 (≠ S297), N309 (≠ K299), N309 (≠ K299), M310 (= M300), D311 (= D301), S348 (= S339), I349 (≠ F340), G350 (= G341), T351 (= T342), N401 (= N385), V402 (= V386), D405 (≠ Q389)
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
37% identity, 93% coverage: 12:404/422 of query aligns to 9:418/425 of 6zgbA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
37% identity, 93% coverage: 12:404/422 of query aligns to 8:417/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ Q184), G195 (≠ F188), R282 (= R275)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ S264), S272 (= S265), S273 (= S266), M307 (= M300), T310 (≠ C303), G353 (= G347), A354 (≠ T348), R394 (= R381), T395 (= T382)
Sites not aligning to the query:
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
37% identity, 93% coverage: 12:404/422 of query aligns to 4:409/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ S264), S265 (= S266), M299 (= M300), T302 (≠ C303), T340 (= T342), G342 (= G344), V343 (= V345), G347 (≠ A349), D383 (= D378), R386 (= R381), T387 (= T382), N390 (= N385)
- binding decyl-beta-d-maltopyranoside: H23 (vs. gap), V212 (≠ L213), A216 (≠ G217)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
33% identity, 92% coverage: 14:400/422 of query aligns to 6:396/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
29% identity, 88% coverage: 19:391/422 of query aligns to 33:393/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ M74), G89 (≠ A75), G92 (= G78), A95 (≠ T81), V96 (≠ F82), Y99 (≠ F85), M163 (≠ G155), F167 (≠ L159), F293 (= F290), V297 (≠ L294)
- binding aspartic acid: S268 (= S265), S269 (= S266), T306 (≠ C303), G346 (= G344), I347 (≠ V345), A350 (≠ T348), G351 (≠ A349), D380 (= D378), R383 (= R381), T384 (= T382)
Q10901 Excitatory amino acid transporter; Sodium-dependent glutamate/ aspartate transporter from Caenorhabditis elegans (see paper)
27% identity, 92% coverage: 3:389/422 of query aligns to 12:449/503 of Q10901
- N177 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N187 (≠ E144) modified: carbohydrate, N-linked (GlcNAc...) asparagine
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
28% identity, 88% coverage: 19:391/422 of query aligns to 25:379/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ V65), S80 (≠ M74), G81 (≠ A75), G84 (= G78), Y91 (≠ F85), M156 (≠ G155), F160 (≠ L159), F286 (= F290), V290 (≠ L294)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (≠ V57), I148 (= I147), S262 (= S266), S263 (≠ F267), A292 (= A296), T293 (≠ S297), M296 (= M300), T299 (≠ C303), G329 (= G341), A336 (≠ T348), G337 (≠ A349), D366 (= D378), R369 (= R381), N373 (= N385)
8cv2A Human excitatory amino acid transporter 3 (eaat3) in an outward facing sodium-bound state (see paper)
29% identity, 78% coverage: 77:407/422 of query aligns to 77:432/433 of 8cv2A
- binding sodium ion: Y85 (≠ F85), T88 (= T88), T89 (≠ A89), G319 (= G295), A320 (= A296), N323 (≠ K299), N323 (≠ K299), M324 (= M300), D325 (= D301), N408 (= N385), D412 (≠ Q389)
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
27% identity, 88% coverage: 19:389/422 of query aligns to 18:403/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S265), S281 (= S266), T318 (≠ C303), G363 (≠ A349), M367 (≠ V353), V385 (= V371), D388 (= D374), R395 (= R381), T396 (= T382)
- binding dodecyl beta-D-glucopyranoside: V19 (≠ F20), I20 (≠ V21), W389 (≠ R375)
- binding cholesterol hemisuccinate: R80 (≠ A76), R84 (= R80), I95 (≠ L91), I252 (vs. gap)
Sites not aligning to the query:
7vr7A Inward-facing structure of human eaat2 in the way213613-bound state (see paper)
28% identity, 88% coverage: 19:389/422 of query aligns to 10:388/402 of 7vr7A
- binding (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en: S57 (≠ A60), L58 (≠ V61), L65 (= L68), V339 (≠ F340), G340 (= G341), S343 (≠ G344), I344 (≠ V345)
- binding cholesterol: W188 (≠ E191), I227 (≠ V233), F250 (= F250), W257 (≠ M257), M379 (= M380), S382 (≠ M383)
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S266 (= S266), M300 (= M300), T303 (≠ C303), Y306 (= Y307), G348 (≠ A349), L349 (≠ T350), M352 (≠ V353), I366 (= I367), L369 (= L370), V370 (= V371), D373 (= D374), D377 (= D378), R380 (= R381), T381 (= T382), N384 (= N385)
Sites not aligning to the query:
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
27% identity, 88% coverage: 19:389/422 of query aligns to 17:404/425 of 7xr4A
P43006 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; Solute carrier family 1 member 2 from Mus musculus (Mouse) (see paper)
26% identity, 91% coverage: 8:389/422 of query aligns to 33:485/572 of P43006
- C38 (≠ W13) modified: S-palmitoyl cysteine; mutation to S: Severely impairs glutamate uptake activity.
Query Sequence
>N515DRAFT_1080 FitnessBrowser__Dyella79:N515DRAFT_1080
MKLVSWWLGIRFWKRVLAGFVLGALAGWLCGPGSVAWFQPLGDVYVALIKMIAVPLVFFA
VVNSVSSLHGVQRMAALGGRTFLWFALTAALAVGVGLLVGHLTDPGLGVGQLTMAGDYKV
REVPSAVKVLLDVVPTNPFRALSEGKILQVIFFAGLLGLALVKIGEKSARLRELFGEAND
AMIQVTRFVLEMTPIGTFGLIAALVAGYGFEKLLPLGKFVLALYAACAVQIVVVYGGLLL
AHGLSPRRFFRGVLPAMQVAFTSSSSFASMPVALRSVTQNLGVSPAYASFAVPLGASIKM
DGCGAIYPAISSIFVAQYFGLQLEPAQYFVILLASVLGSFGTAGVPGTATVMVTLVLSSA
GLPVEGIGYLVAIDRVLDMMRTMTNVTGQMLVPVLVAREQGLLDMDVYLGEAAPAGLQEP
AR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory