Comparing N515DRAFT_1085 FitnessBrowser__Dyella79:N515DRAFT_1085 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
49% identity, 99% coverage: 1:334/336 of query aligns to 1:340/343 of P30750
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
49% identity, 99% coverage: 1:334/336 of query aligns to 2:341/344 of 3tuzC
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
49% identity, 99% coverage: 1:334/336 of query aligns to 2:341/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
48% identity, 99% coverage: 1:334/336 of query aligns to 2:341/344 of 6cvlD
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
44% identity, 73% coverage: 1:246/336 of query aligns to 2:240/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
42% identity, 73% coverage: 1:246/336 of query aligns to 1:240/240 of 4ymuJ
3c4jA Abc protein artp in complex with atp-gamma-s
42% identity, 73% coverage: 2:246/336 of query aligns to 1:242/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
42% identity, 73% coverage: 2:246/336 of query aligns to 1:242/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
42% identity, 73% coverage: 2:246/336 of query aligns to 1:242/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
42% identity, 73% coverage: 2:246/336 of query aligns to 1:242/242 of 2oljA
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
44% identity, 67% coverage: 1:226/336 of query aligns to 1:219/219 of 8w6iD
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
44% identity, 68% coverage: 1:227/336 of query aligns to 1:220/222 of P0A9R7
8hd0A Cell divisome spg hydrolysis machinery ftsex-envc
43% identity, 67% coverage: 1:225/336 of query aligns to 1:218/218 of 8hd0A
8i6rB Cryo-em structure of pseudomonas aeruginosa ftse(e163q)x/envc complex with atp in peptidisc (see paper)
41% identity, 66% coverage: 1:221/336 of query aligns to 1:216/222 of 8i6rB
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
38% identity, 64% coverage: 1:216/336 of query aligns to 3:217/226 of 5xu1B
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
40% identity, 65% coverage: 1:220/336 of query aligns to 1:223/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
39% identity, 65% coverage: 1:220/336 of query aligns to 1:223/230 of 1l2tA
8tzjA Cryo-em structure of vibrio cholerae ftse/ftsx complex (see paper)
44% identity, 61% coverage: 1:205/336 of query aligns to 2:201/220 of 8tzjA
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
36% identity, 66% coverage: 25:245/336 of query aligns to 46:266/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
36% identity, 66% coverage: 25:245/336 of query aligns to 46:266/382 of 7aheC
Sites not aligning to the query:
>N515DRAFT_1085 FitnessBrowser__Dyella79:N515DRAFT_1085
MIRFVDVHKSYRVDGKDIPALQPFSLDIADGEVFGIIGHSGAGKSTLIRLINLLERPSGG
SILIDGTEMTALGDAALRAQRRRIGMIFQHFNLLSSQTVADNIAFPLRLAGETDAGKIKA
RVDELLRRVGLEAHASKYPAQLSGGQKQRVGIARALANRPSILLCDEATSALDPQTTASV
LELLAEINRELKLTIVLITHEMDVVRRVCDRVAVLDAGRIVEHGAVADVFLHPRHPTTRR
FVNEALPEEAAGELAPYTHVPGRILRLSFRGEATWTPALGRVARDTGVDFNILAGRIDRI
KDLPYGQLTLAMQGSGVDQALVALRAAGIEIEELNR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory