SitesBLAST
Comparing N515DRAFT_1104 FitnessBrowser__Dyella79:N515DRAFT_1104 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P14697 Acetoacetyl-CoA reductase; EC 1.1.1.36 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see 2 papers)
54% identity, 100% coverage: 1:245/246 of query aligns to 1:246/246 of P14697
- GGI 13:15 (= GGI 13:15) binding
- G35 (vs. gap) binding
- R40 (= R39) binding
- Q47 (≠ A46) mutation to L: 2.4-fold increase in activity. 2-fold decrease in affinity for NADPH and 2.8-fold decrease in affinity for acetoacetyl-CoA.
- GNV 60:62 (≠ GDV 59:61) binding
- NAGIT 88:92 (= NAGIT 87:91) binding
- D94 (= D93) mutation to A: About 6% of wild-type activity.
- K99 (= K98) mutation to A: Nearly loss of activity.
- Q147 (= Q146) mutation to A: About 30% of wild-type activity.
- F148 (≠ Y147) mutation to A: About 30% of wild-type activity.
- Q150 (= Q149) mutation to A: About 20% of wild-type activity.
- T173 (≠ K172) mutation to S: 3.5-fold increase in activity. 4-fold decrease in affinity for NADPH and 2.4-fold decrease in affinity for acetoacetyl-CoA.
- PGYI 183:186 (≠ PGYV 182:185) binding
- Y185 (= Y184) mutation to A: Nearly loss of activity.
- R195 (≠ P194) mutation to A: Nearly loss of activity.
3vzsB Crystal structure of phab from ralstonia eutropha in complex with acetoacetyl-coa and NADP (see paper)
53% identity, 99% coverage: 2:245/246 of query aligns to 5:249/249 of 3vzsB
- active site: N115 (= N111), S143 (= S139), Y156 (= Y152), K160 (= K156)
- binding acetoacetyl-coenzyme a: D97 (= D93), Q150 (= Q146), F151 (≠ Y147), Q153 (= Q149), Y156 (= Y152), G187 (= G183), Y188 (= Y184), R198 (≠ P194)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G10), I18 (= I15), G38 (vs. gap), R43 (= R39), G63 (= G59), N64 (≠ D60), V65 (= V61), G93 (= G89), I94 (= I90), T95 (= T91), P186 (= P182), I189 (≠ V185), M193 (= M189), V194 (= V190)
4k6fB X-ray crystal structure of a putative acetoacetyl-coa reductase from burkholderia cenocepacia bound to the co-factor NADP
54% identity, 98% coverage: 3:244/246 of query aligns to 1:244/245 of 4k6fB
- active site: G12 (= G14), N102 (≠ Q103), S138 (= S139), Y151 (= Y152), K155 (= K156)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), Y32 (= Y34), S33 (≠ R35), N36 (≠ P37), V58 (≠ G59), D59 (= D60), V60 (= V61), A87 (= A88), G88 (= G89), I89 (= I90)
5vmlA Crystal structure of acetoacetyl-coa reductase from burkholderia pseudomallei 1710b with bound NADP
52% identity, 99% coverage: 2:245/246 of query aligns to 1:245/245 of 5vmlA
- active site: G13 (= G14), N111 (= N111), S139 (= S139), Y152 (= Y152), K156 (= K156)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G10), G12 (= G13), G13 (= G14), I14 (= I15), C33 (≠ Y34), G34 (vs. gap), R39 (≠ A38), G59 (= G59), N60 (≠ D60), V61 (= V61), N87 (= N87), G89 (= G89), I90 (= I90), S139 (= S139), Y152 (= Y152), K156 (= K156), P182 (= P182), G183 (= G183), I185 (≠ V185)
5vt6A Crystal structure of acetoacetyl-coa reductase from burkholderia pseudomallei 1710b complexed with NADP
52% identity, 98% coverage: 3:244/246 of query aligns to 1:244/245 of 5vt6A
- active site: G12 (= G14), D102 (≠ Q103), S138 (= S139), Y151 (= Y152), K155 (= K156)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), G11 (= G13), G12 (= G14), L13 (≠ I15), H32 (≠ Y34), S33 (≠ R35), N36 (≠ A40), V58 (≠ G59), D59 (= D60), V60 (= V61), N86 (= N87), A87 (= A88), G88 (= G89), I89 (= I90), I136 (= I137), Y151 (= Y152), K155 (= K156), P181 (= P182), Y183 (= Y184), L184 (≠ V185), T186 (= T187)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
46% identity, 98% coverage: 4:244/246 of query aligns to 9:246/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G10), S17 (≠ T12), R18 (≠ G13), I20 (= I15), T40 (≠ R35), N62 (≠ D60), V63 (= V61), N89 (= N87), A90 (= A88), I92 (= I90), V139 (≠ I137), S141 (= S139), Y154 (= Y152), K158 (= K156), P184 (= P182), G185 (= G183), I187 (≠ V185), T189 (= T187), M191 (= M189)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
46% identity, 98% coverage: 4:244/246 of query aligns to 6:243/244 of P0AEK2
- GASR 12:15 (≠ GGTG 10:13) binding
- T37 (≠ R35) binding
- NV 59:60 (≠ DV 60:61) binding
- N86 (= N87) binding
- Y151 (= Y152) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (= YAAAK 152:156) binding
- A154 (= A155) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K156) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ V185) binding
- E233 (≠ T234) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
46% identity, 98% coverage: 4:244/246 of query aligns to 5:242/243 of 1q7bA
- active site: G15 (= G14), E101 (≠ Q103), S137 (= S139), Q147 (= Q149), Y150 (= Y152), K154 (= K156)
- binding calcium ion: E232 (≠ T234), T233 (≠ N235)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G10), S13 (≠ T12), R14 (≠ G13), T36 (≠ R35), N58 (≠ D60), V59 (= V61), N85 (= N87), A86 (= A88), G87 (= G89), I88 (= I90), S137 (= S139), Y150 (= Y152), K154 (= K156), P180 (= P182), G181 (= G183), I183 (≠ V185)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
46% identity, 98% coverage: 4:244/246 of query aligns to 9:242/243 of 4i08A
- active site: G19 (= G14), N113 (= N111), S141 (= S139), Q151 (= Q149), Y154 (= Y152), K158 (= K156)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G10), S17 (≠ T12), R18 (≠ G13), I20 (= I15), T40 (≠ R35), N62 (≠ D60), V63 (= V61), N89 (= N87), A90 (= A88), G140 (≠ S138), S141 (= S139), Y154 (= Y152), K158 (= K156), P184 (= P182), G185 (= G183), T189 (= T187)
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
46% identity, 98% coverage: 4:244/246 of query aligns to 5:242/243 of 1q7cA
- active site: G15 (= G14), S137 (= S139), Q147 (= Q149), F150 (≠ Y152), K154 (= K156)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G10), S13 (≠ T12), R14 (≠ G13), A35 (≠ Y34), T36 (≠ R35), L57 (≠ M56), N58 (≠ D60), V59 (= V61), G87 (= G89), I88 (= I90)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
45% identity, 98% coverage: 4:244/246 of query aligns to 6:243/244 of 6t77A
- active site: G16 (= G14), S138 (= S139), Y151 (= Y152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G10), S14 (≠ T12), R15 (≠ G13), T37 (≠ R35), L58 (≠ M56), N59 (≠ D60), V60 (= V61), A87 (= A88), G88 (= G89), I89 (= I90)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
43% identity, 98% coverage: 4:244/246 of query aligns to 5:246/246 of 3osuA
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
45% identity, 98% coverage: 4:244/246 of query aligns to 6:243/244 of P0A2C9
- M125 (= M126) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (≠ T224) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (≠ G225) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
4ag3A Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with NADPH at 1.8a resolution (see paper)
45% identity, 98% coverage: 4:244/246 of query aligns to 13:253/254 of 4ag3A
- active site: G23 (= G14), S148 (= S139), Y161 (= Y152), K165 (= K156)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G19 (= G10), S21 (≠ T12), R22 (≠ G13), G23 (= G14), I24 (= I15), T44 (≠ R35), L68 (≠ G59), D69 (= D60), V70 (= V61), N96 (= N87), A97 (= A88), I146 (= I137), S148 (= S139), Y161 (= Y152), K165 (= K156), P191 (= P182), G192 (= G183), F193 (≠ Y184), I194 (≠ V185), T196 (= T187), M198 (= M189), T199 (≠ V190)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
42% identity, 98% coverage: 4:244/246 of query aligns to 2:239/239 of 3sj7A
- active site: G12 (= G14), S138 (= S139), Q148 (= Q149), Y151 (= Y152), K155 (= K156)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), S10 (≠ T12), R11 (≠ G13), I13 (= I15), N31 (= N33), Y32 (= Y34), A33 (≠ R35), G34 (vs. gap), S35 (≠ D36), A58 (≠ G59), N59 (≠ D60), V60 (= V61), N86 (= N87), A87 (= A88), T109 (= T110), S138 (= S139), Y151 (= Y152), K155 (= K156), P181 (= P182), G182 (= G183)
6wprA Crystal structure of a putative 3-oxoacyl-acp reductase (fabg) with NADP(h) from acinetobacter baumannii (see paper)
42% identity, 99% coverage: 1:244/246 of query aligns to 1:243/244 of 6wprA
- active site: G16 (= G14), S138 (= S139), Y151 (= Y152)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G10), S14 (≠ T12), R15 (≠ G13), T37 (≠ R35), L58 (≠ M56), D59 (= D60), V60 (= V61), N86 (= N87), A87 (= A88), G88 (= G89), I89 (= I90), I136 (= I137), Y151 (= Y152), K155 (= K156), P181 (= P182)
6t62A Crystal structure of acinetobacter baumannii fabg in complex with NADPH at 1.8 a resolution (see paper)
41% identity, 98% coverage: 3:244/246 of query aligns to 5:243/244 of 6t62A
- active site: G16 (= G14), S138 (= S139), Y151 (= Y152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G10), S14 (≠ T12), R15 (≠ G13), A36 (≠ Y34), T37 (≠ R35), L58 (≠ M56), D59 (= D60), V60 (= V61), N86 (= N87), A87 (= A88), G88 (= G89), I89 (= I90), I136 (= I137), S137 (= S138), S138 (= S139), Y151 (= Y152), K155 (= K156), P181 (= P182), G182 (= G183), I184 (≠ V185), M188 (= M189)
4bo4C Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with n-(2-methoxyphenyl)-3,4- dihydro-2h-quinoline-1-carboxamide at 2.7a resolution (see paper)
45% identity, 98% coverage: 4:244/246 of query aligns to 19:254/255 of 4bo4C
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
41% identity, 98% coverage: 4:244/246 of query aligns to 5:242/243 of 7emgB
4bnzA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 1-methyl-n-phenylindole- 3-carboxamide at 2.5a resolution (see paper)
44% identity, 98% coverage: 4:244/246 of query aligns to 8:240/241 of 4bnzA
Query Sequence
>N515DRAFT_1104 FitnessBrowser__Dyella79:N515DRAFT_1104
MTQRTALVTGGTGGIGTAIVRYLARQGHRVATNYRDPARADAWRAAIAQEGIEVAMVQGD
VSDPASCEAMVRELESKLGAVEILVNNAGITRDTTFHKMSYQQWTDVVNTNLNACFNVTR
PVIDGMRGRKWGRIVQISSINGQKGQYGQANYAAAKAGMHGFTISLAQENAKFGITVNTV
SPGYVATDMVMAVPEEVREKIVAQIPVGRLGKPEEIAHAVAFLTGEEAAWITGTNLAING
GHYMGW
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory