SitesBLAST
Comparing N515DRAFT_1105 FitnessBrowser__Dyella79:N515DRAFT_1105 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P27305 Glutamyl-Q tRNA(Asp) synthetase; Glu-Q-RSs; EC 6.1.1.- from Escherichia coli (strain K12) (see paper)
48% identity, 89% coverage: 3:258/288 of query aligns to 16:270/308 of P27305
- E55 (= E42) binding
- Y182 (= Y170) binding
- R200 (= R188) binding
4a91A Crystal structure of the glutamyl-queuosine trnaasp synthetase from e. Coli complexed with l-glutamate (see paper)
49% identity, 89% coverage: 3:258/288 of query aligns to 4:256/290 of 4a91A
- active site: S11 (= S10), K229 (= K229)
- binding glutamic acid: R7 (= R6), A9 (= A8), S11 (= S10), E43 (= E42), Y170 (= Y170), R188 (= R188), L192 (= L192)
- binding zinc ion: C99 (= C98), C101 (= C100), Y113 (≠ H112), C117 (= C117)
Q8DLI5 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1) (see paper)
36% identity, 82% coverage: 1:236/288 of query aligns to 1:258/485 of Q8DLI5
- R6 (= R6) binding
- Y192 (= Y170) binding
2cfoA Non-discriminating glutamyl-tRNA synthetase from thermosynechococcus elongatus in complex with glu (see paper)
36% identity, 82% coverage: 2:236/288 of query aligns to 1:257/484 of 2cfoA
P04805 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Escherichia coli (strain K12) (see 4 papers)
34% identity, 82% coverage: 1:236/288 of query aligns to 1:247/471 of P04805
- C98 (= C98) mutation to S: 10-fold decrease in activity. Strong decrease in zinc content.
- C100 (= C100) mutation to S: Loss of activity. Strong decrease in zinc content.; mutation to Y: Does not prevent zinc binding. Reduces only 2-fold the binding affinity for tRNA(Glu), but reduces more than 10-fold the affinity for glutamate in the presence of tRNA(Glu).
- C125 (= C117) mutation to S: Loss of activity. Strong decrease in zinc content.
- H127 (≠ A119) mutation to Q: 10-fold decrease in activity. Strong decrease in zinc content.
- H129 (≠ P121) mutation to Q: No change in activity or in zinc content.
- H131 (vs. gap) mutation to Q: No change in activity or in zinc content.
- H132 (vs. gap) mutation to Q: No change in activity or in zinc content.
- C138 (≠ P127) mutation to S: No change in activity or in zinc content.
- S239 (= S228) modified: Phosphoserine; mutation to D: Does not aminoacylate tRNA(Glu), not phosphorylated by HipA.
8i9iA Glutamyl-tRNA synthetase from escherichia coli bound to glutamate and zinc
34% identity, 82% coverage: 1:236/288 of query aligns to 1:247/468 of 8i9iA
4g6zA Crystal structure of a glutamyl-tRNA synthetase glurs from burkholderia thailandensis bound to l-glutamate (see paper)
34% identity, 81% coverage: 4:236/288 of query aligns to 4:232/380 of 4g6zA
3al0C Crystal structure of the glutamine transamidosome from thermotoga maritima in the glutamylation state. (see paper)
29% identity, 97% coverage: 4:281/288 of query aligns to 104:388/564 of 3al0C
- active site: S110 (= S10), K335 (= K229)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R106 (= R6), A108 (= A8), P109 (= P9), G118 (= G18), T122 (≠ A22), E142 (= E42), Y276 (= Y170), R294 (= R188), G295 (= G189), D297 (= D191), H298 (≠ L192), L324 (= L218), I325 (≠ A219), L333 (= L227)
- binding : T144 (≠ I44), D145 (= D45), R148 (= R48), Y208 (≠ C100), P213 (≠ L105), K252 (≠ Q145), M255 (≠ Q148), I266 (≠ V160), K269 (≠ R163), S270 (≠ V164), Y276 (= Y170), D297 (= D191), H298 (≠ L192), L299 (= L193), S300 (≠ D194), N301 (≠ S195), K304 (≠ R198), R330 (≠ G224), P332 (≠ K226), G363 (≠ V256), W364 (≠ D257), R365 (≠ A258), E370 (≠ P263), S387 (≠ P280)
Sites not aligning to the query:
- binding : 389, 391, 392, 397, 400, 407, 446, 447, 453, 457, 509, 520, 524, 527, 535, 536, 538, 539
4griB Crystal structure of a glutamyl-tRNA synthetase glurs from borrelia burgdorferi bound to glutamic acid and zinc (see paper)
30% identity, 78% coverage: 4:229/288 of query aligns to 3:253/485 of 4griB
- active site: S9 (= S10), K253 (= K229)
- binding glutamic acid: R5 (= R6), A7 (= A8), S9 (= S10), E41 (= E42), Y194 (= Y170), R212 (= R188), W216 (≠ L192)
- binding zinc ion: C105 (= C98), C107 (= C100), Y128 (vs. gap), C132 (= C117)
8vc5A Crystal structure of glutamyl-tRNA synthetase glurs from pseudomonas aeruginosa (zinc bound)
29% identity, 97% coverage: 2:279/288 of query aligns to 3:301/488 of 8vc5A
6brlA Crystal structure of a glutamate tRNA ligase from elizabethkingia meningosepticum ccug26117 in complex with its amino acid
31% identity, 78% coverage: 4:229/288 of query aligns to 4:261/502 of 6brlA
1g59A Glutamyl-tRNA synthetase complexed with tRNA(glu). (see paper)
33% identity, 81% coverage: 6:237/288 of query aligns to 5:254/468 of 1g59A
- binding : D44 (= D45), R45 (≠ P46), A46 (≠ P47), R47 (= R48), P109 (≠ R102), V145 (≠ A128), R163 (≠ Q145), V166 (≠ Q148), E172 (≠ A155), V177 (= V160), K180 (≠ R163), S181 (≠ V164), D182 (≠ E165), E207 (≠ N190), E208 (≠ D191), R237 (≠ V220), K241 (≠ G224), T242 (≠ R225), K243 (= K226)
Sites not aligning to the query:
- binding : 273, 274, 282, 299, 300, 303, 304, 309, 312, 319, 357, 358, 417, 426, 427, 432, 435, 442, 443, 444, 445, 446, 447, 448
2cv2A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu) and an enzyme inhibitor, glu-ams (see paper)
32% identity, 81% coverage: 6:237/288 of query aligns to 5:254/468 of 2cv2A
- active site: K246 (= K229)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R5 (= R6), A7 (= A8), S9 (= S10), G17 (= G18), I21 (≠ A22), E41 (= E42), Y187 (= Y170), R205 (= R188), A206 (≠ G189), E208 (≠ D191), W209 (≠ L192), L235 (= L218), L236 (≠ A219)
- binding : S9 (= S10), T43 (≠ I44), D44 (= D45), R47 (= R48), V145 (≠ A128), R163 (≠ Q145), Y168 (≠ Q150), E172 (≠ A155), V177 (= V160), K180 (≠ R163), S181 (≠ V164), Y187 (= Y170), E207 (≠ N190), E208 (≠ D191), W209 (≠ L192), V211 (≠ D194), R237 (≠ V220), K241 (≠ G224)
Sites not aligning to the query:
- binding : 272, 273, 274, 282, 299, 303, 304, 309, 312, 319, 357, 358, 417, 432, 435, 442, 443, 444, 446, 447, 448
2cv1A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu), atp, and an analog of l-glutamate: a quaternary complex
32% identity, 81% coverage: 6:237/288 of query aligns to 5:254/468 of 2cv1A
- active site: K246 (= K229)
- binding adenosine-5'-triphosphate: P8 (= P9), S9 (= S10), G17 (= G18), T18 (≠ S19), I21 (≠ A22), R47 (= R48), A206 (≠ G189), W209 (≠ L192), L235 (= L218), L236 (≠ A219)
- binding (4s)-4-amino-5-hydroxypentanoic acid: R5 (= R6), A7 (= A8), E41 (= E42), Y187 (= Y170), R205 (= R188), W209 (≠ L192)
- binding : S9 (= S10), E41 (= E42), T43 (≠ I44), D44 (= D45), R47 (= R48), V145 (≠ A128), R163 (≠ Q145), V166 (≠ Q148), E172 (≠ A155), V177 (= V160), K180 (≠ R163), S181 (≠ V164), Y187 (= Y170), E207 (≠ N190), E208 (≠ D191), W209 (≠ L192), V211 (≠ D194), R237 (≠ V220), K241 (≠ G224), K243 (= K226)
Sites not aligning to the query:
- binding : 273, 274, 276, 282, 299, 303, 304, 309, 312, 319, 357, 358, 417, 427, 432, 435, 442, 443, 444, 446, 447, 448
2cuzA Glutamyl-tRNA synthetase from thermus thermophilus in complex with l- glutamate (see paper)
32% identity, 81% coverage: 6:237/288 of query aligns to 5:254/468 of 2cuzA
1n78A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with tRNA(glu) and glutamol-amp. (see paper)
32% identity, 81% coverage: 6:237/288 of query aligns to 5:254/468 of 1n78A
- active site: K246 (= K229)
- binding glutamol-amp: R5 (= R6), A7 (= A8), P8 (= P9), S9 (= S10), G17 (= G18), T18 (≠ S19), I21 (≠ A22), E41 (= E42), Y187 (= Y170), N191 (≠ C174), R205 (= R188), A206 (≠ G189), E208 (≠ D191), W209 (≠ L192), L235 (= L218), L236 (≠ A219)
- binding : S9 (= S10), T43 (≠ I44), D44 (= D45), R47 (= R48), V145 (≠ A128), R163 (≠ Q145), V166 (≠ Q148), Y168 (≠ Q150), E172 (≠ A155), V177 (= V160), K180 (≠ R163), S181 (≠ V164), Y187 (= Y170), E207 (≠ N190), E208 (≠ D191), W209 (≠ L192), L210 (= L193), V211 (≠ D194), R237 (≠ V220), K241 (≠ G224)
Sites not aligning to the query:
- binding : 273, 274, 282, 297, 303, 304, 309, 312, 319, 357, 358, 417, 427, 432, 435, 442, 443, 444, 446, 447, 448
1j09A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with atp and glu (see paper)
32% identity, 81% coverage: 6:237/288 of query aligns to 5:254/468 of 1j09A
- active site: K246 (= K229)
- binding adenosine-5'-triphosphate: H15 (= H16), E208 (≠ D191), L235 (= L218), L236 (≠ A219), K243 (= K226), I244 (≠ L227), S245 (= S228), K246 (= K229), R247 (≠ S230)
- binding glutamic acid: R5 (= R6), A7 (= A8), S9 (= S10), E41 (= E42), Y187 (= Y170), N191 (≠ C174), R205 (= R188), W209 (≠ L192)
P27000 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
32% identity, 81% coverage: 6:237/288 of query aligns to 5:254/468 of P27000
Sites not aligning to the query:
- 358 R→Q: Reduces affinity for tRNA and abolishes the ability to discriminate between tRNA(Glu) and tRNA(Gln).
3aiiA Archaeal non-discriminating glutamyl-tRNA synthetase from methanothermobacter thermautotrophicus (see paper)
30% identity, 73% coverage: 6:215/288 of query aligns to 14:228/455 of 3aiiA
Sites not aligning to the query:
P46655 Glutamate--tRNA ligase, cytoplasmic; Glutamyl-tRNA synthetase; (c)ERS; GluRS; P85; EC 6.1.1.17 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
23% identity, 70% coverage: 6:208/288 of query aligns to 205:420/708 of P46655
Sites not aligning to the query:
- 148 R→A: Abolishes interaction with ARC1.
Query Sequence
>N515DRAFT_1105 FitnessBrowser__Dyella79:N515DRAFT_1105
MTYRGRFAPSPTGRLHFGSLVAAVASWLCARHAGGRWLLRMEDIDPPREVPGSARDILDA
LPAFGLAADEPVLFQSHRLDAYEAAFQRLRDHDQVFPCWCSRADLAAAGGMHRDGHCVAS
PDPSRAPAWRLRAPDLEIAFVDRLQGPQRQNLRQAAGDFVIKRVEGFYAYQLACAVDDAW
QGVTEVVRGNDLLDSTARQLWLQRCLGLPTPAYLHLPLAVDADGRKLSKSENAHPVDPRD
PLPALQRALHFLDLPVDASANHPDALLSQALAHFDPARLPHCSERPAS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory