SitesBLAST
Comparing N515DRAFT_1230 N515DRAFT_1230 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5wjsA Crystal structure of oxidoreductase (short chain dehydrogenase/reductase family) from burkholderia thailandensis complexed with nadh
62% identity, 99% coverage: 3:253/254 of query aligns to 7:257/258 of 5wjsA
- active site: G27 (= G23), S152 (= S148), Y162 (= Y158), Y165 (= Y161), K169 (= K165)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G23 (= G19), T26 (= T22), I28 (= I24), D47 (= D43), L48 (≠ I44), D73 (= D69), L74 (≠ I70), N100 (= N96), A102 (= A98), L150 (= L146), G151 (= G147), S152 (= S148), K169 (= K165), P195 (= P191), G196 (= G192), W197 (= W193), V198 (= V194), K202 (= K198)
7wwxA Crystal structure of herbaspirillum huttiense l-arabinose 1- dehydrogenase (NAD bound form) (see paper)
51% identity, 99% coverage: 3:254/254 of query aligns to 2:254/254 of 7wwxA
- binding nicotinamide-adenine-dinucleotide: G18 (= G19), T21 (= T22), I23 (= I24), D42 (= D43), I43 (= I44), C68 (= C68), D69 (= D69), L70 (≠ I70), N96 (= N96), A98 (= A98), F146 (≠ L146), S147 (≠ G147), S148 (= S148), Y161 (= Y161), K165 (= K165), P191 (= P191), G192 (= G192), W193 (= W193), V194 (= V194), R198 (≠ K198)
7krmC Putative fabg bound to nadh from acinetobacter baumannii
33% identity, 94% coverage: 16:254/254 of query aligns to 9:242/244 of 7krmC
- active site: G18 (= G23), S140 (= S148), Y155 (= Y161)
- binding nicotinamide-adenine-dinucleotide: G12 (= G19), S15 (≠ T22), G18 (= G23), I19 (= I24), D38 (= D43), L39 (≠ I44), A60 (≠ C68), N61 (≠ D69), V62 (≠ I70), N88 (= N96), V111 (≠ I119), S140 (= S148), Y155 (= Y161), K159 (= K165), I188 (≠ V194), T190 (= T196)
3o4rA Crystal structure of human dehydrogenase/reductase (sdr family) member 4 (dhrs4)
30% identity, 96% coverage: 10:252/254 of query aligns to 6:249/254 of 3o4rA
- active site: G19 (= G23), S145 (= S148), F155 (≠ Y158), Y158 (= Y161), K162 (= K165), K203 (≠ A206)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A15 (≠ G19), T17 (≠ A21), D18 (≠ T22), G19 (= G23), I20 (= I24), S39 (≠ D43), R40 (≠ I44), K41 (≠ D45), N44 (≠ H48), H65 (≠ D69), V66 (≠ I70), N92 (= N96), A94 (= A98), S145 (= S148), Y158 (= Y161), K162 (= K165), P188 (= P191), G189 (= G192), L190 (≠ W193), I191 (≠ V194), T193 (= T196), F195 (≠ K198), S196 (≠ Q199)
Q9BTZ2 Dehydrogenase/reductase SDR family member 4; NADPH-dependent carbonyl reductase; CR; NADPH-dependent retinol dehydrogenase/reductase; NRDR; humNRDR; Peroxisomal short-chain alcohol dehydrogenase; PSCD; SCAD-SRL; Short chain dehydrogenase/reductase family 25C member 2; Protein SDR25C2; Short-chain dehydrogenase/reductase family member 4; EC 1.1.1.184 from Homo sapiens (Human) (see 2 papers)
30% identity, 96% coverage: 10:252/254 of query aligns to 30:273/278 of Q9BTZ2
- S176 (≠ N155) Responsible for the stereoselective reduction of 3-ketosteroids into 3beta-hydroxysteroids and benzil into R-benzoin; mutation to F: Decreased reduction activity for benzil, isatin and retinal and increased activity for 5beta-Pregnane-3,20-dione and 5beta-Dihydrotestosterone. No change of stereoselectivity in 3-ketosteroids reduction and no change in 3beta-hydroxysteroid oxidation. Decreased reduction activity for isatin and increased activity for 5beta-Pregnane-3,20-dione, 5beta-Dihydrotestosterone, benzil and retinal; when associated with L-179. Change in stereoselective activity by the reduction of 5beta-Pregnane-3,20-dione predominantly to the 3alpha-hydroxysteroid; when associated with L-179. Switch from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with L-179. Loss of cold catalytic inactivation; when associated with L-179 and N-195. Increased reduction activity for renital and oxidation activity for retinol; when associated with L-179 and N-195.
- F179 (≠ Y158) Responsible for the stereoselective reduction of 3-ketosteroids into 3beta-hydroxysteroids and benzil into R-benzoin; mutation to L: Decreased reduction activity for isatin and increased activity for 5beta-Pregnane-3,20-dione, 5beta-Dihydrotestosterone, benzil and retinal; when associated with F-176. Change in stereoselective activity by the reduction of 5beta-Pregnane-3,20-dione predominantly to the 3alpha-hydroxysteroid; when associated with F-176. Switch from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with F-176. Loss of cold catalytic inactivation; when associated with F-176 and N-195. Increased reduction activity for renital and oxidation activity for retinol; when associated with F-176 and N-195.
- T195 (≠ G174) mutation to N: Loss of cold catalytic inactivation. Loss of cold catalytic inactivation; when associated with F-176 and L-179. Switch in stereoselective activity from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with F-176 and L-179. Increased reduction activity for renital and oxidation activity for retinol; when associated with F-176 and L-179.
6j7uA Crystal structure of blue fluorescent protein from metagenomic library in complex with NADPH (see paper)
34% identity, 96% coverage: 9:253/254 of query aligns to 2:245/247 of 6j7uA
- active site: G16 (= G23), S142 (= S148), Y156 (= Y161)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G19), S14 (≠ A21), R15 (≠ T22), I17 (= I24), Y36 (≠ D43), V37 (≠ I44), S38 (≠ D45), S41 (vs. gap), D65 (= D69), S66 (≠ I70), N92 (= N96), A93 (= A97), G94 (≠ A98), I115 (= I119), G141 (= G147), S142 (= S148), Y156 (= Y161), K160 (= K165), P186 (= P191), T191 (= T196), M193 (≠ K198), N194 (≠ Q199)
7do7A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NAD and l-rhamnose bound-form) (see paper)
35% identity, 96% coverage: 10:253/254 of query aligns to 3:251/256 of 7do7A
- active site: G16 (= G23), S146 (= S148), Y159 (= Y161)
- binding nicotinamide-adenine-dinucleotide: G12 (= G19), R15 (≠ T22), G16 (= G23), I17 (= I24), S37 (vs. gap), D66 (= D69), A67 (≠ I70), N93 (= N96), A94 (= A97), G95 (≠ A98), I96 (≠ N99), V144 (≠ L146), S145 (≠ G147), S146 (= S148), Y159 (= Y161), K163 (= K165), P189 (= P191), G190 (= G192), I192 (≠ V194), T194 (= T196), I196 (≠ K198)
- binding beta-L-rhamnopyranose: F99 (≠ R102), S146 (= S148), S148 (≠ G150), Q156 (≠ Y158), Y159 (= Y161), N197 (≠ Q199), D235 (= D237), M236 (≠ D238), R238 (= R240)
7b81A Crystal structure of azotobacter vinelandii l-rhamnose 1-dehydrogenase (NAD bound-form) (see paper)
35% identity, 96% coverage: 10:253/254 of query aligns to 3:251/256 of 7b81A
- active site: G16 (= G23), S146 (= S148), Y159 (= Y161)
- binding nicotinamide-adenine-dinucleotide: G12 (= G19), S14 (≠ A21), R15 (≠ T22), I17 (= I24), D66 (= D69), A67 (≠ I70), N93 (= N96), A94 (= A97), G95 (≠ A98), I96 (≠ N99), T116 (≠ I119), V144 (≠ L146), S146 (= S148), Y159 (= Y161), K163 (= K165), P189 (= P191), G190 (= G192), I192 (≠ V194), T194 (= T196), I196 (≠ K198)
8cxaA Crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound NAD
30% identity, 96% coverage: 10:252/254 of query aligns to 3:247/251 of 8cxaA
- binding nicotinamide-adenine-dinucleotide: G12 (= G19), Q15 (≠ T22), G16 (= G23), I17 (= I24), D36 (= D43), V63 (≠ I70), N89 (= N96), A91 (= A98), S94 (vs. gap), I142 (≠ L146), S143 (≠ G147), S144 (= S148), Y157 (= Y161), K161 (= K165), P187 (= P191), H188 (≠ G192), I190 (≠ V194), I194 (≠ K198)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
31% identity, 96% coverage: 10:254/254 of query aligns to 6:246/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G19), R18 (≠ T22), G19 (= G23), I20 (= I24), D39 (= D43), R40 (≠ I44), C63 (= C68), I65 (= I70), N91 (= N96), G93 (≠ A98), I94 (≠ N99), V114 (≠ I119), Y155 (= Y161), K159 (= K165), I188 (≠ V194), T190 (= T196), T193 (≠ Q199)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
31% identity, 96% coverage: 10:253/254 of query aligns to 3:257/260 of 6zzqA
- active site: G17 (= G23), S142 (= S148), Y155 (= Y161)
- binding acetoacetic acid: Q94 (≠ D100), S142 (= S148), K152 (≠ Y158), Y155 (= Y161), Q196 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G13 (= G19), S16 (≠ T22), G17 (= G23), I18 (= I24), D37 (= D43), M38 (≠ I44), D63 (= D69), V64 (≠ I70), N90 (= N96), A91 (= A97), G92 (≠ A98), M140 (≠ L146), A141 (≠ G147), S142 (= S148), Y155 (= Y161), K159 (= K165), Y187 (≠ W193), V188 (= V194), T190 (= T196)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
31% identity, 96% coverage: 10:253/254 of query aligns to 4:258/261 of 6zzsD
- active site: G18 (= G23), S143 (= S148), Y156 (= Y161)
- binding nicotinamide-adenine-dinucleotide: G14 (= G19), S17 (≠ T22), I19 (= I24), D38 (= D43), M39 (≠ I44), D64 (= D69), V65 (≠ I70), N91 (= N96), A92 (= A97), G93 (≠ A98), M141 (≠ L146), A142 (≠ G147), S143 (= S148), Y156 (= Y161), K160 (= K165), P186 (= P191), G187 (= G192), V189 (= V194), T191 (= T196), L193 (vs. gap)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ D100), S143 (= S148), N145 (≠ G150), K153 (≠ Y158), Y156 (= Y161), Q197 (vs. gap)
7do6A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NADP bound-form) (see paper)
35% identity, 96% coverage: 10:253/254 of query aligns to 3:242/247 of 7do6A
- active site: G16 (= G23), S146 (= S148), Y159 (= Y161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G19), S14 (≠ A21), R15 (≠ T22), G16 (= G23), I17 (= I24), H36 (vs. gap), S37 (vs. gap), G42 (≠ D45), D66 (= D69), A67 (≠ I70), N93 (= N96), A94 (= A97), G95 (≠ A98), I96 (≠ N99), T116 (≠ I119), S146 (= S148), Y159 (= Y161), K163 (= K165), I192 (≠ V194)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
29% identity, 96% coverage: 9:253/254 of query aligns to 4:252/255 of 5itvA
- active site: G18 (= G23), S141 (= S148), Y154 (= Y161), K158 (= K165)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G19), S17 (≠ T22), G18 (= G23), I19 (= I24), D38 (= D43), I39 (= I44), T61 (≠ C68), I63 (= I70), N89 (= N96), G91 (≠ A98), T139 (≠ L146), S141 (= S148), Y154 (= Y161), K158 (= K165), P184 (= P191), G185 (= G192), I186 (≠ W193), I187 (≠ V194)
2zatA Crystal structure of a mammalian reductase (see paper)
31% identity, 96% coverage: 10:252/254 of query aligns to 3:246/251 of 2zatA
- active site: G16 (= G23), S142 (= S148), L152 (≠ Y158), Y155 (= Y161), K159 (= K165), K200 (≠ A206)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A12 (≠ G19), T14 (≠ A21), D15 (≠ T22), G16 (= G23), I17 (= I24), S36 (≠ D43), R37 (≠ I44), K38 (≠ D45), N41 (≠ H48), H62 (≠ D69), N89 (= N96), A91 (= A98), V140 (≠ L146), S142 (= S148), Y155 (= Y161), K159 (= K165), P185 (= P191), G186 (= G192), I188 (≠ V194), T190 (= T196), F192 (≠ K198), S193 (≠ Q199)
2ewmB Crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 (see paper)
33% identity, 96% coverage: 10:254/254 of query aligns to 3:245/247 of 2ewmB
- active site: G16 (= G23), S139 (= S148), Y149 (= Y158), Y152 (= Y161), K156 (= K165)
- binding nicotinamide-adenine-dinucleotide: G12 (= G19), N15 (≠ T22), G16 (= G23), I17 (= I24), D36 (= D43), L37 (vs. gap), C59 (= C68), D60 (= D69), V61 (≠ I70), N87 (= N96), S139 (= S148), Y152 (= Y161), K156 (= K165), P182 (= P191), S183 (≠ G192), L184 (≠ W193), V185 (= V194), T189 (≠ K198)
Q8WNV7 Dehydrogenase/reductase SDR family member 4; NADPH-dependent carbonyl reductase; CR; PHCR; NADPH-dependent retinol dehydrogenase/reductase; NDRD; Peroxisomal carbonyl reductase; PerCR; Peroxisomal short-chain alcohol dehydrogenase; PSCD; Short chain dehydrogenase/reductase family 25C member 2; Protein SDR25C2; EC 1.1.1.184; EC 1.1.1.300 from Sus scrofa (Pig) (see 2 papers)
31% identity, 96% coverage: 10:252/254 of query aligns to 31:274/279 of Q8WNV7
- 37:61 (vs. 16:40, 32% identical) binding
- F177 (≠ N155) Responsible for the stereoselective reduction of 3-ketosteroids into 3alpha-hydroxysteroids and benzil into S-benzoin; mutation to S: Change in stereoselective activity by the reduction of 3-ketosteroids and benzil into 3beta-hydroxysteroid and R-benzoin, respectively; when associated with F-180.
- L180 (≠ Y158) Responsible for the stereoselective reduction of 3-ketosteroids into 3alpha-hydroxysteroids and benzil into S-benzoin; mutation to F: Change in stereoselective activity by the reduction of 3-ketosteroids and benzil into 3beta-hydroxysteroid and R-benzoin, respectively; when associated with S-177.
- Y183 (= Y161) active site, Proton acceptor
- K187 (= K165) binding
- N196 (≠ G174) Important for the maintenance of the quaternary structure, the catalytic activity and cold stability
Sites not aligning to the query:
- 277:279 Peroxisomal targeting signal
Q5P5I4 (S)-1-Phenylethanol dehydrogenase; EC 1.1.1.311 from Aromatoleum aromaticum (strain EbN1) (Azoarcus sp. (strain EbN1)) (see 2 papers)
33% identity, 96% coverage: 10:254/254 of query aligns to 5:247/249 of Q5P5I4
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
A0A3Q8GLE8 (+)-cis,cis-nepetalactol synthase NEPS3; Nepetalactol-related short-chain reductase 3; NmNEPS3; EC 5.5.1.35 from Nepeta racemosa (Catmint) (Raceme catnip) (see paper)
32% identity, 93% coverage: 16:252/254 of query aligns to 18:259/270 of A0A3Q8GLE8
- 21:27 (vs. 19:25, 86% identical) binding
- DIQ 46:48 (≠ DID 43:45) binding
- DV 70:71 (≠ DI 69:70) binding
- N97 (= N96) binding
- N150 (≠ L146) mutation to T: No effect on catalytic activity.
- S154 (≠ G150) mutation to L: Abolishes catalytic activity.
- YVMSK 165:169 (≠ YAMAK 161:165) binding
- K169 (= K165) mutation to M: Abolishes catalytic activity.
- M196 (≠ G192) mutation to S: Abolishes catalytic activity.
- VATPL 198:202 (≠ VITEK 194:198) binding
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
31% identity, 97% coverage: 9:254/254 of query aligns to 2:246/247 of 4jroC
- active site: G16 (= G23), S142 (= S148), Q152 (≠ Y158), Y155 (= Y161), K159 (= K165)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G19), S14 (≠ A21), R15 (≠ T22), G16 (= G23), I17 (= I24), N35 (vs. gap), Y36 (≠ V42), N37 (≠ D43), G38 (≠ I44), S39 (≠ D45), N63 (≠ D69), V64 (≠ I70), N90 (= N96), A91 (= A97), I93 (≠ N99), I113 (= I119), S142 (= S148), Y155 (= Y161), K159 (= K165), P185 (= P191), I188 (≠ V194), T190 (= T196)
Query Sequence
>N515DRAFT_1230 N515DRAFT_1230 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family
MSQFATYPSLIDRHVFVSGGATGIGAAFVEHFARQGSRVTFVDIDREHAEALAQSLAGER
HAPRFLPCDITDLDALQASIAAAREAHGPVAVLVNNAANDVRHTFGDTTGEQFDRSIAIN
LRHQYFATQAVREDMRALGGGSVICLGSTGWMKKNAGYPIYAMAKSAVHGLVNGLARELG
HDRIRINALVPGWVITEKQRRLWLDAAGEEEIKRVQCLPGYLMAEDLARAALFLGADDSR
MCTGQSFLVDGGWV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory