SitesBLAST
Comparing N515DRAFT_1250 FitnessBrowser__Dyella79:N515DRAFT_1250 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P20932 (S)-mandelate dehydrogenase; MDH; L(+)-mandelate dehydrogenase; EC 1.1.99.31 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 3 papers)
39% identity, 99% coverage: 1:377/379 of query aligns to 1:372/393 of P20932
- PTG 79:81 (= PTG 79:81) binding
- G81 (= G81) mutation to A: 23-fold decrease in catalytic activity with mandelate as substrate and DCPIP as electron acceptor, but no change in affinity for mandelate. Shows a modestly higher reactivity with molecular oxygen.
- S108 (= S108) binding
- Q129 (= Q129) binding
- T156 (= T157) binding
- K250 (= K253) binding
- DSGFR 303:307 (≠ DGGIL 308:312) binding
- GR 326:327 (≠ GK 331:332) binding
6bfgA Crystal structure of monotopic membrane protein (s)-mandelate dehydrogenase (see paper)
39% identity, 98% coverage: 5:377/379 of query aligns to 3:370/373 of 6bfgA
- active site: Y129 (= Y131), D156 (= D159), H272 (= H277)
- binding flavin mononucleotide: Y24 (= Y26), P77 (= P79), T78 (= T80), G79 (= G81), Q127 (= Q129), Y129 (= Y131), T154 (= T157), K248 (= K253), H272 (= H277), G273 (= G278), R275 (= R280), D301 (= D308), S302 (≠ G309), G303 (= G310), R305 (≠ L312), G324 (= G331), R325 (≠ K332)
6gmcA 1.2 a resolution structure of human hydroxyacid oxidase 1 bound with fmn and 4-carboxy-5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole
37% identity, 97% coverage: 10:377/379 of query aligns to 10:358/360 of 6gmcA
- active site: Y132 (= Y131), D160 (= D159), H258 (= H277)
- binding 5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole-4-carboxylate: Y26 (= Y26), M82 (≠ L82), W110 (≠ V110), Y132 (= Y131), R167 (= R166), F191 (≠ R200), L203 (= L222), Y206 (≠ W225), H258 (= H277), R261 (= R280)
- binding flavin mononucleotide: Y26 (= Y26), Y27 (≠ A27), A79 (≠ P79), T80 (= T80), A81 (≠ G81), S108 (= S108), Q130 (= Q129), Y132 (= Y131), T158 (= T157), K234 (= K253), H258 (= H277), G259 (= G278), R261 (= R280), D289 (= D308), G290 (= G309), R293 (≠ L312), G312 (= G331), R313 (≠ K332)
5qigA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z1407672867
37% identity, 97% coverage: 10:377/379 of query aligns to 7:357/359 of 5qigA
- active site: Y129 (= Y131), D157 (= D159), H257 (= H277)
- binding flavin mononucleotide: Y23 (= Y26), Y24 (≠ A27), A76 (≠ P79), T77 (= T80), A78 (≠ G81), S105 (= S108), Q127 (= Q129), Y129 (= Y131), T155 (= T157), K233 (= K253), H257 (= H277), G258 (= G278), R260 (= R280), D288 (= D308), G289 (= G309), G290 (= G310), R292 (≠ L312), G311 (= G331), R312 (≠ K332)
- binding 2-cyclopropyl-1~{H}-imidazole-4-carboxamide: R223 (= R243), G248 (= G268), F320 (≠ A340), K324 (≠ D344), D328 (≠ R348)
Sites not aligning to the query:
5qifA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z31792168
37% identity, 97% coverage: 10:377/379 of query aligns to 7:357/359 of 5qifA
- active site: Y129 (= Y131), D157 (= D159), H257 (= H277)
- binding flavin mononucleotide: Y23 (= Y26), Y24 (≠ A27), A76 (≠ P79), T77 (= T80), A78 (≠ G81), S105 (= S108), Q127 (= Q129), Y129 (= Y131), K233 (= K253), H257 (= H277), G258 (= G278), R260 (= R280), D288 (= D308), G289 (= G309), R292 (≠ L312), G311 (= G331), R312 (≠ K332)
- binding 2-cyclohexyl-~{N}-pyridin-3-yl-ethanamide: R223 (= R243), R224 (≠ E244), S227 (≠ P247)
2rdwA Crystal structure of human glycolate oxidase in complex with sulfate (see paper)
37% identity, 97% coverage: 10:377/379 of query aligns to 7:357/359 of 2rdwA
- active site: S105 (= S108), Y129 (= Y131), T155 (= T157), D157 (= D159), K233 (= K253), H257 (= H277)
- binding flavin mononucleotide: Y23 (= Y26), Y24 (≠ A27), A76 (≠ P79), T77 (= T80), A78 (≠ G81), Q127 (= Q129), Y129 (= Y131), T155 (= T157), K233 (= K253), H257 (= H277), G258 (= G278), R260 (= R280), D288 (= D308), G289 (= G309), R292 (≠ L312), G311 (= G331), R312 (≠ K332)
- binding sulfate ion: Y23 (= Y26), W107 (≠ V110), R164 (= R166), H257 (= H277), R260 (= R280)
Q8Z0C8 L-lactate oxidase; LOX; Glyoxylate oxidase; No-LOX; EC 1.1.3.-; EC 1.2.3.5 from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) (see paper)
43% identity, 99% coverage: 1:377/379 of query aligns to 4:363/365 of Q8Z0C8
- M82 (≠ T80) mutation to T: Increases oxidation activity with both L-lactate and glycolate. Shows a 6-fold decrease in the L-lactate/glycolate oxidase activity ratio.
- L112 (≠ V110) mutation to W: Impairs oxidation of L-lactate. Shows a 2-fold decrease in the L-lactate/glycolate oxidase activity ratio.
- F212 (≠ I226) mutation to V: Impairs oxidation of L-lactate. Shows a 27-fold decrease in the L-lactate/glycolate oxidase activity ratio.
2rduA Crystal structure of human glycolate oxidase in complex with glyoxylate (see paper)
37% identity, 97% coverage: 10:377/379 of query aligns to 8:358/360 of 2rduA
- active site: S106 (= S108), Y130 (= Y131), T156 (= T157), D158 (= D159), K234 (= K253), H258 (= H277)
- binding flavin mononucleotide: Y24 (= Y26), Y25 (≠ A27), A77 (≠ P79), T78 (= T80), A79 (≠ G81), S106 (= S108), Q128 (= Q129), Y130 (= Y131), T156 (= T157), K234 (= K253), H258 (= H277), G259 (= G278), R261 (= R280), D289 (= D308), G290 (= G309), G291 (= G310), R293 (≠ L312), G312 (= G331), R313 (≠ K332)
- binding glyoxylic acid: Y24 (= Y26), W108 (≠ V110), Y130 (= Y131), R165 (= R166), H258 (= H277), R261 (= R280)
6gmbA Structure of human hydroxyacid oxidase 1 bound with fmn and glycolate
37% identity, 97% coverage: 10:377/379 of query aligns to 10:360/362 of 6gmbA
- active site: Y132 (= Y131), D160 (= D159), H260 (= H277)
- binding flavin mononucleotide: Y26 (= Y26), Y27 (≠ A27), A79 (≠ P79), T80 (= T80), A81 (≠ G81), S108 (= S108), Q130 (= Q129), Y132 (= Y131), K236 (= K253), H260 (= H277), G261 (= G278), R263 (= R280), D291 (= D308), G292 (= G309), G293 (= G310), R295 (≠ L312), G314 (= G331), R315 (≠ K332)
- binding glycolic acid: Y26 (= Y26), W110 (≠ V110), Y132 (= Y131), R167 (= R166), H260 (= H277), R263 (= R280)
Q9UJM8 2-Hydroxyacid oxidase 1; HAOX1; Glycolate oxidase; GO; GOX; Glyoxylate oxidase; EC 1.1.3.15; EC 1.2.3.5 from Homo sapiens (Human) (see 2 papers)
37% identity, 97% coverage: 10:377/379 of query aligns to 10:360/370 of Q9UJM8
1huvA Crystal structure of a soluble mutant of the membrane-associated (s)- mandelate dehydrogenase from pseudomonas putida at 2.15a resolution (see paper)
38% identity, 98% coverage: 5:377/379 of query aligns to 2:346/349 of 1huvA
- active site: S105 (= S108), Y128 (= Y131), T153 (= T157), D155 (= D159), K224 (= K253), H248 (= H277)
- binding flavin mononucleotide: Y23 (= Y26), P76 (= P79), T77 (= T80), G78 (= G81), S105 (= S108), Q126 (= Q129), Y128 (= Y131), T153 (= T157), K224 (= K253), H248 (= H277), G249 (= G278), R251 (= R280), D277 (= D308), S278 (≠ G309), G279 (= G310), R281 (≠ L312), G300 (= G331), R301 (≠ K332)
2a85A Crystal structure of the g81a mutant of the active chimera of (s)- mandelate dehydrogenase in complex with its substrate 2- hydroxyoctanoate (see paper)
38% identity, 98% coverage: 5:377/379 of query aligns to 2:350/353 of 2a85A
- active site: S105 (= S108), Y128 (= Y131), T153 (= T157), D155 (= D159), K228 (= K253), H252 (= H277)
- binding flavin mononucleotide: Y23 (= Y26), P76 (= P79), T77 (= T80), A78 (≠ G81), S105 (= S108), Q126 (= Q129), Y128 (= Y131), T153 (= T157), K228 (= K253), H252 (= H277), G253 (= G278), R255 (= R280), D281 (= D308), S282 (≠ G309), G283 (= G310), R285 (≠ L312), G304 (= G331), R305 (≠ K332)
- binding (2s)-2-hydroxyoctanoic acid: Y128 (= Y131), N159 (≠ Q163), G160 (= G164), R162 (= R166), H252 (= H277), R255 (= R280)
2a7pA Crystal structure of the g81a mutant of the active chimera of (s)- mandelate dehydrogenase in complex with its substrate 3-indolelactate (see paper)
38% identity, 98% coverage: 5:377/379 of query aligns to 2:350/353 of 2a7pA
- active site: S105 (= S108), Y128 (= Y131), T153 (= T157), D155 (= D159), K228 (= K253), H252 (= H277)
- binding 3-(indol-3-yl) lactate: Y128 (= Y131), R162 (= R166), H252 (= H277)
- binding flavin mononucleotide: Y23 (= Y26), P76 (= P79), T77 (= T80), A78 (≠ G81), S105 (= S108), Q126 (= Q129), Y128 (= Y131), T153 (= T157), K228 (= K253), H252 (= H277), G253 (= G278), R255 (= R280), D281 (= D308), S282 (≠ G309), G283 (= G310), R285 (≠ L312), G304 (= G331), R305 (≠ K332)
5qieA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z2856434894
37% identity, 97% coverage: 10:377/379 of query aligns to 7:351/353 of 5qieA
- active site: Y129 (= Y131), D157 (= D159), H251 (= H277)
- binding flavin mononucleotide: Y23 (= Y26), Y24 (≠ A27), A76 (≠ P79), T77 (= T80), A78 (≠ G81), S105 (= S108), Q127 (= Q129), Y129 (= Y131), K227 (= K253), H251 (= H277), G252 (= G278), R254 (= R280), D282 (= D308), G283 (= G309), R286 (≠ L312), G305 (= G331), R306 (≠ K332)
- binding ~{N},~{N}-dimethyl-4-[(propan-2-ylamino)methyl]aniline: D322 (≠ R348)
Sites not aligning to the query:
7r4nA Structure of human hydroxyacid oxidase 1 bound with 5-bromo-n-methyl- 1h-indazole-3-carboxamide
36% identity, 97% coverage: 10:377/379 of query aligns to 9:350/352 of 7r4nA
- binding 5-bromanyl-N-methyl-1H-indazole-3-carboxamide: Y25 (= Y26), A80 (≠ G81), M81 (≠ L82), W109 (≠ V110), Y131 (= Y131), R166 (= R166), M182 (≠ L182), H250 (= H277), R253 (= R280)
- binding flavin mononucleotide: Y25 (= Y26), Y26 (≠ A27), A78 (≠ P79), T79 (= T80), A80 (≠ G81), S107 (= S108), W109 (≠ V110), Q129 (= Q129), Y131 (= Y131), T157 (= T157), K226 (= K253), H250 (= H277), G251 (= G278), R253 (= R280), D281 (= D308), G282 (= G309), R285 (≠ L312), G304 (= G331), R305 (≠ K332)
5qihA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z2697514548
36% identity, 97% coverage: 10:377/379 of query aligns to 7:342/344 of 5qihA
- active site: Y129 (= Y131), D157 (= D159), H242 (= H277)
- binding flavin mononucleotide: Y23 (= Y26), Y24 (≠ A27), A76 (≠ P79), T77 (= T80), A78 (≠ G81), S105 (= S108), Q127 (= Q129), Y129 (= Y131), K218 (= K253), H242 (= H277), G243 (= G278), R245 (= R280), D273 (= D308), G274 (= G309), R277 (≠ L312), G296 (= G331), R297 (≠ K332)
- binding 1-methylindazole-3-carboxamide: Y23 (= Y26), A78 (≠ G81), M79 (≠ L82), W107 (≠ V110), Y129 (= Y131), M180 (≠ L182), L187 (= L222), H242 (= H277)
5qidA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z1787627869
36% identity, 97% coverage: 10:377/379 of query aligns to 7:342/344 of 5qidA
- active site: Y129 (= Y131), D157 (= D159), H242 (= H277)
- binding flavin mononucleotide: Y23 (= Y26), Y24 (≠ A27), A76 (≠ P79), T77 (= T80), A78 (≠ G81), S105 (= S108), Q127 (= Q129), Y129 (= Y131), K218 (= K253), H242 (= H277), G243 (= G278), R245 (= R280), D273 (= D308), G274 (= G309), R277 (≠ L312), G296 (= G331), R297 (≠ K332)
- binding 5-chloranyl-~{N}-methyl-~{N}-[[(3~{S})-oxolan-3-yl]methyl]pyrimidin-4-amine: T57 (≠ R60), E320 (≠ R355), R323 (≠ S358)
5qicA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z30620520
36% identity, 97% coverage: 10:377/379 of query aligns to 7:342/344 of 5qicA
- active site: Y129 (= Y131), D157 (= D159), H242 (= H277)
- binding flavin mononucleotide: Y23 (= Y26), Y24 (≠ A27), A76 (≠ P79), T77 (= T80), A78 (≠ G81), S105 (= S108), Q127 (= Q129), Y129 (= Y131), K218 (= K253), H242 (= H277), G243 (= G278), R245 (= R280), D273 (= D308), G274 (= G309), R277 (≠ L312), G296 (= G331), R297 (≠ K332)
- binding cyclopropyl-[4-(4-fluorophenyl)piperazin-1-yl]methanone: Y131 (≠ M133), K132 (≠ R134), V136 (≠ F138), M180 (≠ L182), F183 (= F186), Y190 (≠ W225), K193 (≠ N228), A194 (≠ Q229)
5qibA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with fmopl000388a
36% identity, 97% coverage: 10:377/379 of query aligns to 7:342/344 of 5qibA
- active site: Y129 (= Y131), D157 (= D159), H242 (= H277)
- binding 1-deoxy-1-(7,8-dimethyl-2,4-dioxo-3,4-dihydro-2h-benzo[g]pteridin-1-id-10(5h)-yl)-5-o-phosphonato-d-ribitol: Y23 (= Y26), Y24 (≠ A27), A76 (≠ P79), T77 (= T80), A78 (≠ G81), S105 (= S108), Q127 (= Q129), Y129 (= Y131), K218 (= K253), H242 (= H277), G243 (= G278), R245 (= R280), D273 (= D308), G274 (= G309), G275 (= G310), R277 (≠ L312), G296 (= G331), R297 (≠ K332)
- binding 5-(cyclohexylamino)pyrimidine-2,4(1H,3H)-dione: Y23 (= Y26), M79 (≠ L82), W107 (≠ V110), Y129 (= Y131), R164 (= R166), M180 (≠ L182), L187 (= L222), H242 (= H277), R245 (= R280)
7r4oA Structure of human hydroxyacid oxidase 1 bound with 2-((4h-1,2,4- triazol-3-yl)thio)-1-(4-(3-chlorophenyl)piperazin-1-yl)ethan-1-one
36% identity, 97% coverage: 10:377/379 of query aligns to 8:339/341 of 7r4oA
- binding flavin mononucleotide: Y25 (≠ A27), A77 (≠ P79), T78 (= T80), A79 (≠ G81), S106 (= S108), Q128 (= Q129), Y130 (= Y131), K215 (= K253), H239 (= H277), G240 (= G278), R242 (= R280), D270 (= D308), G271 (= G309), R274 (≠ L312), G293 (= G331), R294 (≠ K332)
- binding 2-((4H-1,2,4-triazol-3-yl)thio)-1-(4-(3-chlorophenyl)piperazin-1-yl)ethan-1-one: Y132 (≠ M133), K133 (≠ R134), D134 (= D135), N183 (= N184), K190 (≠ N228)
Query Sequence
>N515DRAFT_1250 FitnessBrowser__Dyella79:N515DRAFT_1250
MATPITNVLDLRELARRRVPRAFFEYADRGAYDEVTLRGNRAALESIKFRQRVMMNVDQR
SLATSVVGQPISMPLAIAPTGLTGLQHGAGEILGARAATKAGIPFCLSTVSICSIEQVRD
AVQAPFWFQLYVMRDRGFARDLIRRASDAGCSALMLTADLTVQGQRHREIKNGLSVPPKI
TLRNLFDVMSKPRWAWSMLRAPSRSFGNLAGRIQGTDSLTTLAQWIANQFDPTLNWQDLE
WIRELWPGKLILKGIMDEEDARLAAAHGVDAIVVSNHGGRQLDGAPASIEVLPRIADAVG
DKLDVLFDGGILSGQDVLKALALGARAGLIGKAFLYGLGALGEDGVARTIEIIRRELSVS
MALTGQTDVRRIGRDVLWR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory