SitesBLAST
Comparing N515DRAFT_1253 FitnessBrowser__Dyella79:N515DRAFT_1253 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
D4A1J4 Dehydrogenase/reductase SDR family member 6; (R)-beta-hydroxybutyrate dehydrogenase; 3-hydroxybutyrate dehydrogenase type 2; 4-oxo-L-proline reductase; Oxidoreductase UCPA; Short chain dehydrogenase/reductase family 15C member 1; EC 1.1.1.-; EC 1.1.1.30; EC 1.1.1.104 from Rattus norvegicus (Rat) (see paper)
56% identity, 99% coverage: 3:247/248 of query aligns to 2:244/245 of D4A1J4
- Y147 (= Y149) mutation to F: Loss of function.
Q8JZV9 Dehydrogenase/reductase SDR family member 6; (R)-beta-hydroxybutyrate dehydrogenase; 3-hydroxybutyrate dehydrogenase type 2; 4-oxo-L-proline reductase; Oxidoreductase UCPA; Short chain dehydrogenase/reductase family 15C member 1; EC 1.1.1.-; EC 1.1.1.30; EC 1.1.1.104 from Mus musculus (Mouse) (see paper)
56% identity, 99% coverage: 3:247/248 of query aligns to 2:244/245 of Q8JZV9
- Y147 (= Y149) active site, Proton acceptor; mutation to F: Loss of function.
Q9BUT1 Dehydrogenase/reductase SDR family member 6; (R)-beta-hydroxybutyrate dehydrogenase; 3-hydroxybutyrate dehydrogenase type 2; 4-oxo-L-proline reductase; Oxidoreductase UCPA; Short chain dehydrogenase/reductase family 15C member 1; EC 1.1.1.-; EC 1.1.1.30; EC 1.1.1.104 from Homo sapiens (Human) (see 4 papers)
57% identity, 99% coverage: 3:247/248 of query aligns to 2:244/245 of Q9BUT1
2ag5A Crystal structure of human dhrs6 (see paper)
57% identity, 99% coverage: 3:247/248 of query aligns to 2:244/246 of 2ag5A
- active site: S133 (= S135), Y147 (= Y149), K151 (= K153), R192 (≠ L194)
- binding nicotinamide-adenine-dinucleotide: Q16 (≠ A17), G17 (= G18), I18 (= I19), D37 (= D38), I38 (= I39), D58 (= D60), V59 (= V61), V81 (≠ C83), G83 (= G85), L104 (≠ I106), Y147 (= Y149), K151 (= K153), P177 (= P179), V180 (= V182), T182 (= T184), S184 (= S186)
- binding sulfate ion: R144 (= R146), R188 (= R190), F202 (= F205), R205 (= R208)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
36% identity, 99% coverage: 3:247/248 of query aligns to 1:246/248 of 6ixmC
- active site: G16 (= G18), S142 (= S135), Y155 (= Y149), K159 (= K153)
- binding nicotinamide-adenine-dinucleotide: G12 (≠ A14), S15 (≠ A17), G16 (= G18), I17 (= I19), D36 (= D38), I37 (= I39), A61 (≠ L59), D62 (= D60), T63 (≠ V61), N89 (≠ C83), A90 (= A84), M140 (= M133), S142 (= S135), Y155 (= Y149), K159 (= K153), P185 (= P179), A186 (≠ G180), Y187 (≠ T181), I188 (≠ V182), L192 (≠ S186)
7v1qA Leifsonia alcohol dehydrogenases lnadh (see paper)
37% identity, 98% coverage: 5:247/248 of query aligns to 6:249/251 of 7v1qA
- binding nicotinamide-adenine-dinucleotide: G15 (≠ A14), S18 (≠ A17), G19 (= G18), I20 (= I19), D39 (= D38), L40 (≠ I39), D65 (= D60), V66 (= V61), N91 (≠ C83), M142 (= M133), Y157 (= Y149), K161 (= K153), P187 (= P179), G188 (= G180), F189 (≠ T181), I190 (≠ V182)
4ituA Crystal structure of s-2-hydroxypropyl coenzyme m dehydrogenase (s- hpcdh) bound to s-hpc and nadh (see paper)
39% identity, 88% coverage: 29:247/248 of query aligns to 27:251/253 of 4ituA
- active site: N113 (= N107), S141 (= S135), Y154 (= Y149), K158 (= K153)
- binding 2-{[(2S)-2-hydroxypropyl]sulfanyl}ethanesulfonic acid: S141 (= S135), Y154 (= Y149), T186 (= T181), R209 (≠ F205), Y213 (≠ Q209)
- binding 1,4-dihydronicotinamide adenine dinucleotide: D36 (= D38), L37 (≠ I39), D62 (= D60), V63 (= V61), N89 (≠ C83), V112 (≠ I106), F139 (≠ M133), S141 (= S135), Y154 (= Y149), K158 (= K153), P184 (= P179), T186 (= T181), V187 (= V182), T190 (≠ P185), M192 (≠ L187)
Sites not aligning to the query:
A7IQH5 2-(S)-hydroxypropyl-CoM dehydrogenase 3; S-HPCDH 3; 2-[(S)-2-hydroxypropylthio]ethanesulfonate dehydrogenase 3; Aliphatic epoxide carboxylation component IV; Epoxide carboxylase component IV; SHPCDH3; EC 1.1.1.269 from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) (see 2 papers)
39% identity, 88% coverage: 29:247/248 of query aligns to 29:253/255 of A7IQH5
- D38 (= D38) binding
- DV 64:65 (= DV 60:61) binding
- N91 (≠ C83) binding
- S143 (= S135) binding ; mutation to A: Retains very weak activity.
- Y156 (= Y149) binding ; mutation to A: Retains some activity but with more than 2200-fold decrease in catalytic efficiency.; mutation to F: Loss of activity.
- K160 (= K153) binding ; mutation to A: Loss of activity.
- T188 (= T181) binding
- VTSTG 189:193 (≠ VKTPS 182:186) binding
- R211 (≠ F205) mutation to A: Severely impaired in the oxidation of S-HPC or reduction of 2-KPC but largely unaffected in the oxidation and reduction of aliphatic alcohols and ketones.
- K214 (≠ R208) mutation to A: Severely impaired in the oxidation of S-HPC or reduction of 2-KPC but largely unaffected in the oxidation and reduction of aliphatic alcohols and ketones.
- Y215 (≠ Q209) binding
Sites not aligning to the query:
5jc8D Crystal structure of a putative short-chain dehydrogenase/reductase from burkholderia xenovorans
37% identity, 99% coverage: 2:247/248 of query aligns to 1:258/262 of 5jc8D
3lqfA Crystal structure of the short-chain dehydrogenase galactitol- dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD and erythritol (see paper)
39% identity, 98% coverage: 4:247/248 of query aligns to 8:252/254 of 3lqfA
- active site: G22 (= G18), S144 (= S135), Y159 (= Y149), K163 (= K153)
- binding meso-erythritol: N151 (≠ G142), Y159 (= Y149), Y191 (≠ T181), T197 (≠ G188), M200 (≠ V191)
- binding nicotinamide-adenine-dinucleotide: G18 (≠ A14), S21 (≠ A17), G22 (= G18), I23 (= I19), D42 (= D38), R43 (≠ I39), D66 (= D60), V67 (= V61), S92 (≠ C83), L142 (≠ M133), S144 (= S135), K163 (= K153), P189 (= P179), V192 (= V182), T194 (= T184), M196 (≠ L187), T197 (≠ G188)
2wsbA Crystal structure of the short-chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD (see paper)
39% identity, 98% coverage: 4:247/248 of query aligns to 8:252/254 of 2wsbA
- active site: G22 (= G18), S144 (= S135), Y159 (= Y149), K163 (= K153)
- binding nicotinamide-adenine-dinucleotide: G18 (≠ A14), S21 (≠ A17), G22 (= G18), I23 (= I19), D42 (= D38), R43 (≠ I39), D66 (= D60), V67 (= V61), S92 (≠ C83), A93 (= A84), L142 (≠ M133), S144 (= S135), Y159 (= Y149), K163 (= K153), P189 (= P179), V192 (= V182), T194 (= T184), M196 (≠ L187), T197 (≠ G188)
- binding n-propanol: S144 (= S135), M145 (≠ V136), N151 (≠ G142), N151 (≠ G142), Y159 (= Y149), Y159 (= Y149), Y191 (≠ T181)
2wdzA Crystal structure of the short chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD+ and 1,2-pentandiol (see paper)
39% identity, 98% coverage: 4:247/248 of query aligns to 8:252/254 of 2wdzA
- active site: G22 (= G18), S144 (= S135), Y159 (= Y149), K163 (= K153)
- binding (2S)-pentane-1,2-diol: A45 (≠ E41), D49 (≠ A45), R62 (= R58), S146 (≠ A137), Y159 (= Y149)
- binding nicotinamide-adenine-dinucleotide: G18 (≠ A14), S21 (≠ A17), G22 (= G18), I23 (= I19), D42 (= D38), R43 (≠ I39), A65 (vs. gap), D66 (= D60), V67 (= V61), S92 (≠ C83), A93 (= A84), L142 (≠ M133), S144 (= S135), Y159 (= Y149), K163 (= K153), P189 (= P179), V192 (= V182), T194 (= T184), M196 (≠ L187), T197 (≠ G188)
C0KTJ6 Galactitol 2-dehydrogenase (L-tagatose-forming); Galactitol dehydrogenase; GDH; GatDH; Galactitol:NAD(+) 5-oxidoreductase; EC 1.1.1.406 from Cereibacter sphaeroides (Rhodobacter sphaeroides) (see paper)
39% identity, 98% coverage: 4:247/248 of query aligns to 8:252/254 of C0KTJ6
Sites not aligning to the query:
4gh5A Crystal structure of s-2-hydroxypropyl coenzyme m dehydrogenase (s- hpcdh) (see paper)
39% identity, 88% coverage: 29:247/248 of query aligns to 27:246/248 of 4gh5A
- active site: N113 (= N107), S141 (= S135), Y154 (= Y149), K158 (= K153)
- binding nicotinamide-adenine-dinucleotide: D36 (= D38), L37 (≠ I39), A61 (≠ L59), D62 (= D60), V63 (= V61), N89 (≠ C83), A90 (= A84), V112 (≠ I106), F139 (≠ M133), S141 (= S135), Y154 (= Y149), K158 (= K153), P184 (= P179), V187 (= V182), T190 (≠ P185), G191 (≠ S186), M192 (≠ L187)
Sites not aligning to the query:
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
36% identity, 98% coverage: 5:246/248 of query aligns to 3:245/248 of 4urfB
- active site: G16 (= G18), S142 (= S135), I152 (≠ R146), Y155 (= Y149), K159 (= K153)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (≠ M211), R211 (≠ G212), R212 (= R213)
- binding bicarbonate ion: I92 (≠ Y86), G94 (≠ H88), R109 (= R102), R179 (= R173), S228 (= S229)
- binding nicotinamide-adenine-dinucleotide: G12 (≠ A14), G14 (= G16), N15 (≠ A17), G16 (= G18), I17 (= I19), D36 (= D38), I37 (= I39), D62 (= D60), T63 (≠ V61), N89 (≠ C83), A90 (= A84), G91 (= G85), I140 (≠ M133), Y155 (= Y149), K159 (= K153), P185 (= P179), A186 (≠ G180), I188 (≠ V182), T190 (= T184)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
36% identity, 98% coverage: 5:246/248 of query aligns to 3:245/248 of 4urfA
- active site: G16 (= G18), S142 (= S135), I152 (≠ R146), Y155 (= Y149), K159 (= K153)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (≠ Y86), S93 (≠ V87), G94 (≠ H88), E95 (≠ A89), T97 (= T91), E101 (≠ D94), T103 (≠ D96), Q106 (≠ A99), R109 (= R102), S175 (≠ G169), G177 (= G171)
- binding magnesium ion: S237 (≠ T238), Y238 (≠ V239)
- binding nicotinamide-adenine-dinucleotide: G12 (≠ A14), G14 (= G16), N15 (≠ A17), G16 (= G18), I17 (= I19), D36 (= D38), I37 (= I39), W41 (vs. gap), D62 (= D60), T63 (≠ V61), N89 (≠ C83), A90 (= A84), G91 (= G85), I140 (≠ M133), Y155 (= Y149), K159 (= K153), P185 (= P179), I188 (≠ V182), T190 (= T184)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
36% identity, 98% coverage: 5:246/248 of query aligns to 3:245/248 of 4ureB
- active site: G16 (= G18), S142 (= S135), I152 (≠ R146), Y155 (= Y149), K159 (= K153)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ A17), G16 (= G18), I17 (= I19), N89 (≠ C83), G91 (= G85), Y155 (= Y149), P185 (= P179), A186 (≠ G180)
P9WGT1 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase; NADH-dependent 3alpha, 20beta-hydroxysteroid dehydrogenase; EC 1.1.1.53 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
40% identity, 99% coverage: 1:245/248 of query aligns to 1:237/260 of P9WGT1
- I6 (≠ A6) mutation to T: Maximal improvement in solubility; when associated with M-47 and K-69.
- RGM 17:19 (≠ AGI 17:19) binding
- D38 (= D38) binding
- V47 (≠ A46) mutation to M: Maximal improvement in solubility; when associated with T-6 and K-69.
- DV 61:62 (= DV 60:61) binding
- T69 (vs. gap) mutation to K: Maximal improvement in solubility; when associated with T-6 and M-47.
- N88 (≠ C83) binding
- S140 (= S135) mutation to A: Complete loss of both oxidation of androsterone and reduction of progesterone; when associated with T6; M-47 and K-69.
- Y153 (= Y149) binding ; mutation to F: Complete loss of both oxidation of androsterone and reduction of progesterone; when associated with T6; M-47 and K-69.
- K157 (= K153) binding
- 183:191 (vs. 179:188, 60% identical) binding
1nfqA Rv2002 gene product from mycobacterium tuberculosis (see paper)
39% identity, 98% coverage: 2:245/248 of query aligns to 1:236/244 of 1nfqA
- active site: G17 (= G18), S139 (= S135), Y152 (= Y149), K156 (= K153)
- binding Androsterone: L91 (≠ V87), E141 (≠ S138), C149 (≠ R146), Y152 (= Y149), V193 (= V191), I197 (≠ V206), F198 (≠ E207)
- binding 1,4-dihydronicotinamide adenine dinucleotide: R16 (≠ A17), G17 (= G18), M18 (≠ I19), D37 (= D38), L39 (vs. gap), L59 (= L59), D60 (= D60), V61 (= V61), N87 (≠ C83), A88 (= A84), I137 (≠ M133), S139 (= S135), Y152 (= Y149), K156 (= K153), P182 (= P179), V185 (= V182), T187 (= T184), P188 (= P185), M189 (≠ L187), T190 (≠ G188)
1nffA Crystal structure of rv2002 gene product from mycobacterium tuberculosis (see paper)
39% identity, 98% coverage: 2:245/248 of query aligns to 1:236/244 of 1nffA
- active site: G17 (= G18), S139 (= S135), Y152 (= Y149), K156 (= K153)
- binding nicotinamide-adenine-dinucleotide: G13 (≠ A14), R16 (≠ A17), G17 (= G18), M18 (≠ I19), D37 (= D38), I38 (= I39), L39 (vs. gap), L59 (= L59), D60 (= D60), V61 (= V61), N87 (≠ C83), A88 (= A84), G89 (= G85), I90 (≠ Y86), I137 (≠ M133), S139 (= S135), Y152 (= Y149), K156 (= K153), P182 (= P179), V185 (= V182), T187 (= T184), P188 (= P185), M189 (≠ L187), T190 (≠ G188)
Query Sequence
>N515DRAFT_1253 FitnessBrowser__Dyella79:N515DRAFT_1253
MSGRLAGKHALVTAAGAGIGRATALAFAREGARVLATDIDEQALAALSAEAPELRTERLD
VTDPVQIDRLVASHPPFDVLFNCAGYVHAGTILDTDDAAWKRSFAINVDSMFHLCQRVLP
AMLERGGGSIVNMSSVASSIKGVPNRFAYSTTKAAVIGLTKSVAADFVGRGIRCNAICPG
TVKTPSLGDRVRALGGDEDAVWRGFVERQPMGRLGNPEEIAMLALYLASDEAAFTTGTVH
IVDGGWSN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory