Comparing N515DRAFT_1255 FitnessBrowser__Dyella79:N515DRAFT_1255 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ezlA Rice l-galactose dehydrogenase (holo form)
31% identity, 87% coverage: 20:315/342 of query aligns to 12:281/318 of 7ezlA
7eziA Rice l-galactose dehydrogenase (apo form)
31% identity, 87% coverage: 20:315/342 of query aligns to 17:286/323 of 7eziA
7svqA Crystal structure of l-galactose dehydrogenase from spinacia oleracea in complex with NAD+ (see paper)
29% identity, 87% coverage: 14:311/342 of query aligns to 5:276/315 of 7svqA
Sites not aligning to the query:
P77256 NADH-specific methylglyoxal reductase; AKR11B2; EC 1.1.1.- from Escherichia coli (strain K12) (see paper)
25% identity, 87% coverage: 27:323/342 of query aligns to 22:311/326 of P77256
6ow0B Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
29% identity, 90% coverage: 14:321/342 of query aligns to 4:284/301 of 6ow0B
1ynqB Aldo-keto reductase akr11c1 from bacillus halodurans (holo form) (see paper)
28% identity, 95% coverage: 15:338/342 of query aligns to 1:296/298 of 1ynqB
1ynpB Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
28% identity, 95% coverage: 15:338/342 of query aligns to 1:296/298 of 1ynpB
1pz0A Structure of NADPH-dependent family 11 aldo-keto reductase akr11a(holo) (see paper)
28% identity, 65% coverage: 35:255/342 of query aligns to 26:218/311 of 1pz0A
P46336 Aldo-keto reductase IolS; AKR11A; Vegetative protein 147; VEG147; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
28% identity, 65% coverage: 35:255/342 of query aligns to 27:219/310 of P46336
6ow0A Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
27% identity, 90% coverage: 14:321/342 of query aligns to 4:308/323 of 6ow0A
1ynpA Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
27% identity, 95% coverage: 15:338/342 of query aligns to 1:281/283 of 1ynpA
3erpA Structure of idp01002, a putative oxidoreductase from and essential gene of salmonella typhimurium (see paper)
26% identity, 79% coverage: 45:314/342 of query aligns to 44:288/312 of 3erpA
Sites not aligning to the query:
5t79A X-ray crystal structure of a novel aldo-keto reductases for the biocatalytic conversion of 3-hydroxybutanal to 1,3-butanediol (see paper)
25% identity, 79% coverage: 45:314/342 of query aligns to 45:293/315 of 5t79A
Sites not aligning to the query:
1pz1A Structure of NADPH-dependent family 11 aldo-keto reductase akr11b(holo) (see paper)
24% identity, 86% coverage: 20:314/342 of query aligns to 10:291/333 of 1pz1A
P80874 Aldo-keto reductase YhdN; AKR11B; General stress protein 69; GSP69; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
24% identity, 86% coverage: 20:314/342 of query aligns to 10:291/331 of P80874
Q3L181 Perakine reductase; EC 1.1.1.317 from Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) (see paper)
26% identity, 68% coverage: 19:249/342 of query aligns to 9:214/337 of Q3L181
3v0sA Crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during NADPH binding (see paper)
25% identity, 70% coverage: 19:256/342 of query aligns to 9:214/287 of 3v0sA
Sites not aligning to the query:
4exaF Crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa (see paper)
34% identity, 39% coverage: 56:188/342 of query aligns to 62:165/259 of 4exaF
Sites not aligning to the query:
5danA Crystal structure of a novel aldo keto reductase tm1743 from thermotoga maritima in complex with NADP+
25% identity, 68% coverage: 18:248/342 of query aligns to 8:207/274 of 5danA
Sites not aligning to the query:
6kiyA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor epalrestat (see paper)
25% identity, 68% coverage: 18:248/342 of query aligns to 9:208/275 of 6kiyA
Sites not aligning to the query:
>N515DRAFT_1255 FitnessBrowser__Dyella79:N515DRAFT_1255
MADPGIPNPHGAGRHAPRRGPAVSRLAFGGAPIGNLYAGVDETIARLAVERAWQHGIRHF
DTAPYYGYGLAEQRLGAALAGVPRASYTLSTKVGRLIEDAPGRDALADGFDVAGKRAVFD
YSRDGVRRAVDASLRRLGVEHVDVLLLHDIGALTHGAGHPRILRQALDEALPALAELRAQ
GVCGAIGLGVNEEAVCLEVMPRFELDVIMLAGRYTLFEQEHGAQVMAEALQRGVSIFAAA
PYNSGLLGGDQPGDTYNYAPADAAVRARAQRFYDVCAEAGASVGAAALQFPLFHPAVATV
VCGMRTPAEADAAAARRDTALPEQLWPRLRAAGLLGEHAVTP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory