SitesBLAST
Comparing N515DRAFT_1294 FitnessBrowser__Dyella79:N515DRAFT_1294 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gy3B Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
42% identity, 84% coverage: 29:181/183 of query aligns to 4:152/154 of 8gy3B
- binding fe2/s2 (inorganic) cluster: G38 (≠ A63), C39 (= C64), G40 (≠ T65), G42 (= G67), C44 (= C69), G45 (≠ S70), C47 (= C72), C59 (= C84), C97 (= C128), C100 (= C130), Q101 (= Q131), C132 (= C161), C134 (= C163)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q96 (≠ P127), C134 (= C163)
1ffuD Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
34% identity, 85% coverage: 28:182/183 of query aligns to 5:156/156 of 1ffuD
- binding fe2/s2 (inorganic) cluster: C41 (= C64), S44 (≠ G67), H45 (≠ R68), C46 (= C69), G47 (≠ S70), C49 (= C72), C61 (= C84), C100 (≠ P127), G101 (≠ C128), C103 (= C130), C135 (= C161), C137 (= C163)
1ffvA Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava (see paper)
34% identity, 85% coverage: 28:182/183 of query aligns to 4:155/155 of 1ffvA
- binding fe2/s2 (inorganic) cluster: I38 (≠ F62), C40 (= C64), S43 (≠ G67), C45 (= C69), G46 (≠ S70), C48 (= C72), C60 (= C84), C99 (≠ P127), G100 (≠ C128), C102 (= C130), C134 (= C161), C136 (= C163)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q98 (≠ P126), C136 (= C163)
4zohC Crystal structure of glyceraldehyde oxidoreductase (see paper)
35% identity, 84% coverage: 28:180/183 of query aligns to 12:160/161 of 4zohC
- binding fe2/s2 (inorganic) cluster: C47 (= C64), S50 (≠ G67), C52 (= C69), G53 (≠ S70), C55 (= C72), C67 (= C84), C106 (= C128), G107 (vs. gap), C109 (= C130), C141 (= C161), C143 (= C163)
- binding pterin cytosine dinucleotide: Q105 (≠ P127), C143 (= C163)
5y6qA Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
37% identity, 84% coverage: 27:180/183 of query aligns to 4:155/157 of 5y6qA
- binding fe2/s2 (inorganic) cluster: G40 (≠ A63), C41 (= C64), D42 (≠ T65), G44 (= G67), C46 (= C69), G47 (≠ S70), C49 (= C72), C61 (= C84), C101 (= C128), G102 (vs. gap), C104 (= C130), C136 (= C161), C138 (= C163)
- binding pterin cytosine dinucleotide: Q100 (≠ P127), C138 (= C163)
P77165 Aldehyde oxidoreductase iron-sulfur-binding subunit PaoA; EC 1.2.99.6 from Escherichia coli (strain K12) (see paper)
34% identity, 90% coverage: 18:182/183 of query aligns to 53:229/229 of P77165
- C99 (= C64) binding
- C104 (= C69) binding
- G105 (≠ S70) binding
- C107 (= C72) binding
- C119 (= C84) binding
- C158 (= C128) binding
- C161 (= C130) binding
- C208 (= C161) binding
- C210 (= C163) binding
1sb3C Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
39% identity, 82% coverage: 28:177/183 of query aligns to 5:151/161 of 1sb3C
- binding fe2/s2 (inorganic) cluster: Q39 (≠ F62), C41 (= C64), G44 (= G67), C46 (= C69), G47 (≠ S70), C49 (= C72), C61 (= C84), C100 (= C128), G101 (≠ P129), C103 (= C130), C135 (= C161), C137 (= C163)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (≠ P127), C137 (= C163)
5g5gA Escherichia coli periplasmic aldehyde oxidase (see paper)
34% identity, 87% coverage: 18:177/183 of query aligns to 2:173/175 of 5g5gA
- binding fe2/s2 (inorganic) cluster: G47 (≠ A63), C48 (= C64), D49 (≠ T65), G51 (= G67), C53 (= C69), G54 (≠ S70), C56 (= C72), C68 (= C84), C107 (= C128), G108 (vs. gap), C110 (= C130), C157 (= C161), C159 (= C163)
3hrdD Crystal structure of nicotinate dehydrogenase (see paper)
34% identity, 83% coverage: 28:179/183 of query aligns to 6:154/160 of 3hrdD
- binding flavin-adenine dinucleotide: E44 (≠ N66), G45 (= G67), E46 (≠ R68)
- binding fe2/s2 (inorganic) cluster: E40 (≠ F62), C42 (= C64), S43 (≠ T65), G45 (= G67), C47 (= C69), G48 (≠ S70), C50 (= C72), C62 (= C84), Q100 (≠ P127), C101 (= C128), G102 (vs. gap), C104 (= C130), C136 (= C161), C138 (= C163)
- binding pterin cytosine dinucleotide: Q100 (≠ P127), C138 (= C163)
Q0QLF3 Nicotinate dehydrogenase small FeS subunit; NDH; Nicotinic acid hydroxylase small FeS subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
34% identity, 83% coverage: 28:179/183 of query aligns to 6:154/157 of Q0QLF3
- C42 (= C64) binding
- C47 (= C69) binding
- C50 (= C72) binding
- C62 (= C84) binding
- C101 (= C128) binding
- C104 (= C130) binding
- C136 (= C161) binding
- C138 (= C163) binding
1n5wA Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
31% identity, 84% coverage: 28:181/183 of query aligns to 4:155/161 of 1n5wA
- binding flavin-adenine dinucleotide: S43 (≠ G67), H44 (≠ R68)
- binding fe2/s2 (inorganic) cluster: I38 (≠ F62), G39 (≠ A63), C40 (= C64), S43 (≠ G67), C45 (= C69), G46 (≠ S70), C48 (= C72), C60 (= C84), C100 (≠ P127), G101 (≠ C128), C103 (= C130), C135 (= C161), C137 (= C163)
P19921 Carbon monoxide dehydrogenase small chain; CO dehydrogenase subunit S; CO-DH S; EC 1.2.5.3 from Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) (Oligotropha carboxidovorans) (see 2 papers)
31% identity, 84% coverage: 28:181/183 of query aligns to 6:157/166 of P19921
- C42 (= C64) binding
- C47 (= C69) binding
- C50 (= C72) binding
- C62 (= C84) binding
- C102 (≠ P127) binding
- C105 (= C130) binding
- C137 (= C161) binding
- C139 (= C163) binding
1n5wD Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
31% identity, 84% coverage: 28:181/183 of query aligns to 4:155/158 of 1n5wD
- binding flavin-adenine dinucleotide: S43 (≠ G67), H44 (≠ R68)
- binding fe2/s2 (inorganic) cluster: C40 (= C64), S43 (≠ G67), C45 (= C69), G46 (≠ S70), C48 (= C72), C60 (= C84), C100 (≠ P127), G101 (≠ C128), C103 (= C130), C135 (= C161), C137 (= C163)
- binding pterin cytosine dinucleotide: Q99 (≠ P126), C137 (= C163)
4usaA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with trans-cinnamaldehyde (see paper)
37% identity, 68% coverage: 30:153/183 of query aligns to 6:126/907 of 4usaA
- binding fe2/s2 (inorganic) cluster: V38 (≠ F62), C40 (= C64), E41 (≠ T65), G43 (= G67), C45 (= C69), G46 (≠ S70), C48 (= C72), R58 (= R82), C60 (= C84), C100 (= C128), G101 (≠ P129), C103 (= C130)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (≠ P127)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 531, 532, 535, 539
- binding fe2/s2 (inorganic) cluster: 137, 139
- binding hydrocinnamic acid: 255, 425, 494, 497, 535, 626
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 139, 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us9A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with 3- phenylpropionaldehyde (see paper)
37% identity, 68% coverage: 30:153/183 of query aligns to 6:126/907 of 4us9A
- binding fe2/s2 (inorganic) cluster: V38 (≠ F62), C40 (= C64), E41 (≠ T65), G43 (= G67), C45 (= C69), G46 (≠ S70), C48 (= C72), R58 (= R82), C60 (= C84), C100 (= C128), G101 (≠ P129), C103 (= C130)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (≠ P127)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding 3-phenylpropanal: 255, 257, 258, 752
- binding bicarbonate ion: 460, 498, 531, 532, 535, 539, 890, 892
- binding fe2/s2 (inorganic) cluster: 137, 139
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 139, 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us8A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with benzaldehyde (see paper)
37% identity, 68% coverage: 30:153/183 of query aligns to 6:126/907 of 4us8A
- binding fe2/s2 (inorganic) cluster: V38 (≠ F62), C40 (= C64), E41 (≠ T65), G43 (= G67), C45 (= C69), G46 (≠ S70), C48 (= C72), R58 (= R82), C60 (= C84), C100 (= C128), G101 (≠ P129), C103 (= C130)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (≠ P127)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 498, 531, 532, 535, 539
- binding fe2/s2 (inorganic) cluster: 137, 139
- binding benzaldehyde: 255, 255, 394, 425, 425, 425, 425, 497, 497, 501, 531, 535, 535, 626, 626, 626, 694, 696, 697
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 139, 420, 421, 422, 533, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4c7yA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide (see paper)
37% identity, 68% coverage: 30:153/183 of query aligns to 6:126/907 of 4c7yA
- binding fe2/s2 (inorganic) cluster: C40 (= C64), E41 (≠ T65), G43 (= G67), C45 (= C69), G46 (≠ S70), C48 (= C72), R58 (= R82), C60 (= C84), C100 (= C128), G101 (≠ P129), C103 (= C130)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (≠ P127)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 498, 531, 535, 539
- binding fe2/s2 (inorganic) cluster: 137, 139
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 139, 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
- binding hydrogen peroxide: 696, 697, 869
3fc4A Ethylene glycol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
37% identity, 68% coverage: 30:153/183 of query aligns to 6:126/907 of 3fc4A
- binding fe2/s2 (inorganic) cluster: V38 (≠ F62), C40 (= C64), E41 (≠ T65), G43 (= G67), C45 (= C69), G46 (≠ S70), C48 (= C72), R58 (= R82), C60 (= C84), C100 (= C128), G101 (≠ P129), C103 (= C130)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (≠ P127)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding 1,2-ethanediol: 535, 622, 696, 697, 869
- binding fe2/s2 (inorganic) cluster: 137, 139
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 139, 419, 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
3fahA Glycerol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
37% identity, 68% coverage: 30:153/183 of query aligns to 6:126/907 of 3fahA
- binding fe2/s2 (inorganic) cluster: V38 (≠ F62), C40 (= C64), E41 (≠ T65), G43 (= G67), C45 (= C69), G46 (≠ S70), C48 (= C72), R58 (= R82), C60 (= C84), C100 (= C128), G101 (≠ P129), C103 (= C130)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (≠ P127)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding fe2/s2 (inorganic) cluster: 137, 139
- binding glycerol: 416, 535, 622, 683, 696, 697, 869, 884, 889, 890, 892
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 139, 419, 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
1sijA Crystal structure of the aldehyde dehydrogenase (a.K.A. Aor or mop) of desulfovibrio gigas covalently bound to [aso3]- (see paper)
37% identity, 68% coverage: 30:153/183 of query aligns to 6:126/907 of 1sijA
- binding fe2/s2 (inorganic) cluster: V38 (≠ F62), C40 (= C64), E41 (≠ T65), G43 (= G67), C45 (= C69), G46 (≠ S70), C48 (= C72), R58 (= R82), C60 (= C84), Q99 (≠ P127), C100 (= C128), G101 (≠ P129), C103 (= C130)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (≠ P127)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding arsenite: 535, 696, 697, 869
- binding fe2/s2 (inorganic) cluster: 137, 139
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 139, 420, 421, 422, 533, 653, 654, 655, 656, 695, 696, 698, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
Query Sequence
>N515DRAFT_1294 FitnessBrowser__Dyella79:N515DRAFT_1294
MSANPSRLPIDAPDTAAAPEPGPKGCAMRLSVNGQSRAIQADPDTPLLRVLRQELGLTGA
GFACTNGRCSACTVHVNDRPTRACRVPVYLVQGTEVVTIEGLAAREGLPPGQLHAVQRAW
IEYGVPPCPCQSGMIMAATALLMDKPDPSPAEIEAALCLDCGCGARPHVLRAIRSLAERM
RSW
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory