Comparing N515DRAFT_1317 FitnessBrowser__Dyella79:N515DRAFT_1317 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
4qhzC Crystal structure of a putative glycosyl hydrolase (bdi_3914) from parabacteroides distasonis atcc 8503 at 2.13 a resolution
57% identity, 88% coverage: 31:259/260 of query aligns to 15:240/240 of 4qhzC
>N515DRAFT_1317 FitnessBrowser__Dyella79:N515DRAFT_1317
MTARLALALLPFALATGVAMAQNAPPAGDPKATEQWEPVPPVVTPGQRDAAPPSDAIVLF
DGHQLDQWEASKDHSPAHWKVHDGVMTVDKTTGNIQTKRRFRNYQLHLEWQVPKNISGEG
QARGNSGVFVASTGPGDEGYEVQILDSYRNKTYVNGQAAAIYKQTPPLANAMRPPGEWQA
YDIVWTAPVFAADGSVQSPAYVTLFHNGIVVQNHTRLTGETLYIGKPVYKAYTDAPIKLQ
AHGDPSAPISFRNIWVRPLD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory