Comparing N515DRAFT_1321 FitnessBrowser__Dyella79:N515DRAFT_1321 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
7w2jD Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
25% identity, 98% coverage: 8:561/565 of query aligns to 4:537/537 of 7w2jD
8jejA Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
25% identity, 98% coverage: 8:561/565 of query aligns to 7:540/540 of 8jejA
8grjB Crystal structure of gamma-alpha subunit complex from burkholderia cepacia fad glucose dehydrogenase in complex with gluconolactone
24% identity, 80% coverage: 111:560/565 of query aligns to 91:531/531 of 8grjB
Sites not aligning to the query:
7qvaA Crystal structure of a bacterial pyranose 2-oxidase in complex with mangiferin (see paper)
26% identity, 36% coverage: 355:560/565 of query aligns to 252:452/457 of 7qvaA
Sites not aligning to the query:
4mifB Pyranose 2-oxidase from phanerochaete chrysosporium, wild type from natural source (see paper)
23% identity, 24% coverage: 424:560/565 of query aligns to 444:580/581 of 4mifB
Sites not aligning to the query:
4migA Pyranose 2-oxidase from phanerochaete chrysosporium, recombinant wild type (see paper)
23% identity, 24% coverage: 424:560/565 of query aligns to 433:569/570 of 4migA
Sites not aligning to the query:
4mihA Pyranose 2-oxidase from phanerochaete chrysosporium, recombinant h158a mutant (see paper)
23% identity, 24% coverage: 424:560/565 of query aligns to 439:575/576 of 4mihA
Sites not aligning to the query:
7qfdA Crystal structure of a bacterial pyranose 2-oxidase complex with d- glucose (see paper)
26% identity, 25% coverage: 420:560/565 of query aligns to 310:453/458 of 7qfdA
Sites not aligning to the query:
7qf8A Crystal structure of a bacterial pyranose 2-oxidase from pseudoarthrobacter siccitolerans (see paper)
27% identity, 23% coverage: 431:560/565 of query aligns to 358:487/494 of 7qf8A
Sites not aligning to the query:
>N515DRAFT_1321 FitnessBrowser__Dyella79:N515DRAFT_1321
MDNKHVYDAIVVGTGVSGGWAAKELTEKGLKTLVLDRGPMVKHGDYPTAMKAPWELPYGD
EPTRHDIERHPIHTRPSFYGITQSTKHWFVDDIDNPYEETRPFDWFRGYHVGGRSLMWGR
QSYRLSPMDLEANGKEGVGVDWPIRYDDIAPWYDYVEHFIGVSGSIEHMPQLPDGDFLPP
MELTCVEKDFRDKIAGKFGGRKLIIGRTANLSAPLKHDKSPQRAPCQYRNLCMRGCPFGA
YFSSNSSTLPAAEKTGNMTMVTNAIVYELIYDNDKGKATGVRVLDAETGHQTEYFAKVIF
MCASTFGSTHILLNSTSSRFPNGFGNDSGELGHNIMDHLFGSGARAMVDGYDDRYYSGRR
PNGFYIPRYRNVGSDKSSFLRGYGYQGGASRQDWTRLVNTPLIGGDLKRAAQTPGPWSIS
MMGFGEMLPSHRNKVTLDRNRKDKYGLPVLNFDAAHEENELAIGKAIVDDALEMMSAAGY
RDVRSFKVQANVGAGIHEMGTARMGRDPKTSVLNGWNQMHACKNVYVTDGSFMASSGCQN
PSLTYMAMTARAASHAVEELKRGNI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory