SitesBLAST
Comparing N515DRAFT_1348 FitnessBrowser__Dyella79:N515DRAFT_1348 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5vt3B High resolution structure of thioredoxin-disulfide reductase from vibrio vulnificus cmcp6 in complex with NADP and fad
68% identity, 98% coverage: 1:313/319 of query aligns to 3:316/319 of 5vt3B
- active site: C138 (= C135), C141 (= C138), D142 (= D139)
- binding flavin-adenine dinucleotide: G15 (= G13), S16 (= S14), G17 (= G15), P18 (= P16), A19 (= A17), T38 (= T36), G39 (= G37), Q41 (= Q39), G44 (= G42), Q45 (= Q43), L46 (= L44), T49 (= T47), N54 (= N52), H86 (= H83), I87 (= I84), S114 (≠ A111), T115 (= T112), G116 (= G113), E162 (= E159), H247 (= H244), G287 (= G284), D288 (= D285), R295 (= R292), Q296 (= Q293), A297 (= A294), S300 (= S297)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L122 (= L119), G156 (= G153), G157 (= G154), N158 (= N155), T159 (= T156), H178 (= H175), R179 (= R176), R180 (= R177), R184 (= R181), I245 (= I242), G246 (= G243), R295 (= R292), Q296 (= Q293)
P0A9P4 Thioredoxin reductase; TRXR; EC 1.8.1.9 from Escherichia coli (strain K12) (see 2 papers)
68% identity, 98% coverage: 1:313/319 of query aligns to 1:315/321 of P0A9P4
- M1 (= M1) modified: Initiator methionine, Removed
- 36:43 (vs. 36:43, 63% identical) binding
- C136 (= C135) modified: Disulfide link with 139, Redox-active
- C139 (= C138) modified: Disulfide link with 136, Redox-active
- 287:296 (vs. 285:294, 80% identical) binding
1f6mA Crystal structure of a complex between thioredoxin reductase, thioredoxin, and the NADP+ analog, aadp+ (see paper)
67% identity, 97% coverage: 3:313/319 of query aligns to 2:314/320 of 1f6mA
- active site: S135 (≠ C135), C138 (= C138), D139 (= D139)
- binding 3-aminopyridine-adenine dinucleotide phosphate: L119 (= L119), G153 (= G153), G154 (= G154), N155 (= N155), T156 (= T156), E159 (= E159), H175 (= H175), R176 (= R176), R177 (= R177), R181 (= R181), I243 (= I242), G244 (= G243), H245 (= H244), R293 (= R292), Q294 (= Q293)
- binding flavin-adenine dinucleotide: G12 (= G13), S13 (= S14), G14 (= G15), P15 (= P16), A16 (= A17), T35 (= T36), G36 (= G37), E38 (≠ Q39), G41 (= G42), Q42 (= Q43), L43 (= L44), T46 (= T47), V49 (= V50), N51 (= N52), H83 (= H83), I84 (= I84), A111 (= A111), T112 (= T112), G113 (= G113), H245 (= H244), G285 (= G284), D286 (= D285), R293 (= R292), Q294 (= Q293), A295 (= A294), S298 (= S297)
1tdfA Crystal structure of escherichia coli thioredoxin reductase refined at 2 angstrom resolution: implications for a large conformational change during catalysis (see paper)
67% identity, 97% coverage: 3:313/319 of query aligns to 2:314/316 of 1tdfA
- active site: C135 (= C135), S138 (≠ C138), D139 (= D139)
- binding flavin-adenine dinucleotide: G12 (= G13), S13 (= S14), G14 (= G15), P15 (= P16), A16 (= A17), T35 (= T36), G36 (= G37), E38 (≠ Q39), G41 (= G42), Q42 (= Q43), L43 (= L44), T46 (= T47), V49 (= V50), N51 (= N52), H83 (= H83), I84 (= I84), A111 (= A111), T112 (= T112), S138 (≠ C138), G285 (= G284), D286 (= D285), R293 (= R292), Q294 (= Q293), A295 (= A294), S298 (= S297)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L119 (= L119), I151 (≠ V151), T156 (= T156), E159 (= E159), H175 (= H175), R176 (= R176), R181 (= R181), E183 (= E183), I243 (= I242), G244 (= G243), H290 (= H289), R293 (= R292)
5u63B Crystal structure of putative thioredoxin reductase from haemophilus influenzae
65% identity, 99% coverage: 1:315/319 of query aligns to 4:319/319 of 5u63B
- active site: C139 (= C135), C142 (= C138), D143 (= D139)
- binding flavin-adenine dinucleotide: G16 (= G13), S17 (= S14), G18 (= G15), P19 (= P16), A20 (= A17), T39 (= T36), G40 (= G37), Q42 (= Q39), G45 (= G42), Q46 (= Q43), L47 (= L44), T50 (= T47), N55 (= N52), H87 (= H83), I88 (= I84), A115 (= A111), T116 (= T112), G117 (= G113), H248 (= H244), G288 (= G284), D289 (= D285), R296 (= R292), Q297 (= Q293), A298 (= A294), S301 (= S297)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R121 (≠ K117), G157 (= G153), H179 (= H175), R180 (= R176), R181 (= R177), I246 (= I242), G247 (= G243), H248 (= H244), R296 (= R292)
4jnqA Crystal structure of a thioredoxin reductase from brucella melitensis
58% identity, 98% coverage: 3:315/319 of query aligns to 3:314/315 of 4jnqA
- active site: C137 (= C135), C140 (= C138), D141 (= D139)
- binding dihydroflavine-adenine dinucleotide: I12 (≠ L12), G13 (= G13), S14 (= S14), G15 (= G15), P16 (= P16), A17 (= A17), A36 (≠ T36), G37 (= G37), Q39 (= Q39), G42 (= G42), Q43 (= Q43), L44 (= L44), N52 (= N52), I85 (= I84), A113 (= A111), T114 (= T112), C140 (= C138), G283 (= G284), D284 (= D285), R291 (= R292), Q292 (= Q293), A293 (= A294)
P9WHH1 Thioredoxin reductase; TR; TRXR; EC 1.8.1.9 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
49% identity, 97% coverage: 4:312/319 of query aligns to 5:315/335 of P9WHH1
- SGPA 22:25 (= SGPA 14:17) binding
- Y32 (= Y24) modified: Phosphotyrosine; by PtkA; mutation to A: Significantly reduces phosphorylation.
- 44:51 (vs. 36:43, 38% identical) binding
- N60 (= N52) binding
- V93 (≠ I84) binding
- C145 (= C135) modified: Disulfide link with 148, Redox-active
- C148 (= C138) modified: Disulfide link with 145, Redox-active
- S166 (≠ T156) binding
- H185 (= H175) binding
- R191 (= R181) binding
- I248 (= I242) binding
- Y268 (= Y261) binding
- D288 (= D285) binding
- R295 (= R292) binding
- RQAV 295:298 (≠ RQAI 292:295) binding
2a87A Crystal structure of m. Tuberculosis thioredoxin reductase (see paper)
50% identity, 95% coverage: 9:312/319 of query aligns to 8:306/313 of 2a87A
- active site: F39 (≠ Q40), L43 (= L44), D48 (= D49), C136 (= C135), C139 (= C138), D140 (= D139)
- binding flavin-adenine dinucleotide: G12 (= G13), S13 (= S14), G14 (= G15), P15 (= P16), A16 (= A17), F34 (≠ V35), E35 (≠ T36), G36 (= G37), G40 (= G41), G41 (= G42), A42 (≠ Q43), L43 (= L44), T46 (= T47), V49 (= V50), N51 (= N52), D83 (≠ H83), V84 (≠ I84), M113 (≠ T112), C139 (= C138), G278 (= G284), D279 (= D285), R286 (= R292), Q287 (= Q293), A288 (= A294), V289 (≠ I295)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L120 (= L119), G155 (= G154), D156 (≠ N155), S157 (≠ T156), H176 (= H175), R177 (= R176), R178 (= R177), R182 (= R181), I239 (= I242), Y259 (= Y261), R283 (≠ H289), R286 (= R292)
8ccmA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with compound 2-06
49% identity, 96% coverage: 9:315/319 of query aligns to 5:305/305 of 8ccmA
- binding flavin-adenine dinucleotide: I8 (≠ L12), G9 (= G13), S10 (= S14), G11 (= G15), P12 (= P16), A13 (= A17), E32 (≠ T36), G33 (= G37), Q35 (= Q39), G38 (= G42), A39 (≠ Q43), L40 (= L44), T43 (= T47), N48 (= N52), D80 (≠ H83), V81 (≠ I84), M109 (≠ T112), G110 (= G113), T131 (≠ A134), C135 (= C138), G274 (= G284), D275 (= D285), R282 (= R292), Q283 (= Q293), A284 (= A294), A287 (≠ S297)
- binding ~{N}6-(4-aminophenyl)-1,2-benzothiazole-3,6-diamine: R114 (≠ K117), H115 (≠ Y118), L116 (= L119), R173 (= R176), E200 (≠ T206), I201 (≠ V207), I235 (= I242)
8cclA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry a09
49% identity, 96% coverage: 9:315/319 of query aligns to 5:305/305 of 8cclA
- binding flavin-adenine dinucleotide: I8 (≠ L12), G9 (= G13), S10 (= S14), G11 (= G15), P12 (= P16), A13 (= A17), E32 (≠ T36), G33 (= G37), Q35 (= Q39), G38 (= G42), A39 (≠ Q43), L40 (= L44), T43 (= T47), N48 (= N52), D80 (≠ H83), V81 (≠ I84), M109 (≠ T112), G110 (= G113), T131 (≠ A134), C135 (= C138), G274 (= G284), D275 (= D285), R282 (= R292), Q283 (= Q293), A284 (= A294), A287 (≠ S297)
- binding [1,2]thiazolo[5,4-b]pyridin-3-amine: L116 (= L119), R173 (= R176), E200 (≠ T206), I201 (≠ V207)
8cckA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry h07
49% identity, 96% coverage: 9:315/319 of query aligns to 5:305/305 of 8cckA
- binding flavin-adenine dinucleotide: G9 (= G13), S10 (= S14), G11 (= G15), P12 (= P16), A13 (= A17), E32 (≠ T36), G33 (= G37), Q35 (= Q39), G38 (= G42), A39 (≠ Q43), L40 (= L44), T43 (= T47), N48 (= N52), D80 (≠ H83), V81 (≠ I84), M109 (≠ T112), G110 (= G113), T131 (≠ A134), C135 (= C138), G274 (= G284), D275 (= D285), R282 (= R292), Q283 (= Q293), A284 (= A294), A287 (≠ S297)
- binding ~{N}-(4-hydroxyphenyl)-2-pyrazol-1-yl-ethanamide: R114 (≠ K117), H115 (≠ Y118), L116 (= L119), V148 (= V151), R173 (= R176), E200 (≠ T206), I201 (≠ V207)
8ccjA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with NADPH
49% identity, 96% coverage: 9:315/319 of query aligns to 5:305/305 of 8ccjA
- binding flavin-adenine dinucleotide: I8 (≠ L12), G9 (= G13), S10 (= S14), G11 (= G15), P12 (= P16), A13 (= A17), E32 (≠ T36), G33 (= G37), Q35 (= Q39), G38 (= G42), A39 (≠ Q43), L40 (= L44), T43 (= T47), N48 (= N52), D80 (≠ H83), V81 (≠ I84), M109 (≠ T112), G110 (= G113), T131 (≠ A134), C135 (= C138), G274 (= G284), D275 (= D285), R282 (= R292), Q283 (= Q293), A284 (= A294), A287 (≠ S297)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G150 (= G153), G151 (= G154), D152 (≠ N155), S153 (≠ T156), E156 (= E159), H172 (= H175), R173 (= R176), R174 (= R177), R178 (= R181), I235 (= I242)
5uthA Crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad
49% identity, 96% coverage: 9:315/319 of query aligns to 6:306/306 of 5uthA
- active site: C133 (= C135), C136 (= C138), D137 (= D139)
- binding flavin-adenine dinucleotide: I9 (≠ L12), G10 (= G13), S11 (= S14), G12 (= G15), P13 (= P16), A14 (= A17), F32 (≠ V35), E33 (≠ T36), G34 (= G37), Q36 (= Q39), G39 (= G42), A40 (≠ Q43), L41 (= L44), N49 (= N52), D81 (≠ H83), V82 (≠ I84), M110 (≠ T112), G111 (= G113), C136 (= C138), G275 (= G284), D276 (= D285), R283 (= R292), Q284 (= Q293), A285 (= A294), A288 (≠ S297)
P29509 Thioredoxin reductase 1; TR; TrxR; Thioredoxin peroxidase 1; TPx; Thioredoxin-dependent peroxide reductase 1; EC 1.8.1.9 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 3 papers)
46% identity, 96% coverage: 6:312/319 of query aligns to 3:315/319 of P29509
- SGPA 11:14 (= SGPA 14:17) binding
- IA 40:41 (≠ LQ 38:39) binding
- Q45 (= Q43) binding
- N54 (= N52) binding
- V87 (≠ I84) binding
- C142 (= C135) modified: Disulfide link with 145, Redox-active
- C145 (= C138) binding ; modified: Disulfide link with 142, Redox-active
- D288 (= D285) binding
- RQA 295:297 (= RQA 292:294) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3d8xA Crystal structure of saccharomyces cerevisiae ndpph dependent thioredoxin reductase 1 (see paper)
46% identity, 96% coverage: 6:312/319 of query aligns to 2:314/318 of 3d8xA
- active site: C141 (= C135), C144 (= C138), D145 (= D139)
- binding flavin-adenine dinucleotide: I8 (≠ L12), S10 (= S14), G11 (= G15), P12 (= P16), A13 (= A17), Y31 (vs. gap), G33 (vs. gap), A36 (≠ V35), I39 (≠ L38), G43 (= G42), Q44 (= Q43), I51 (≠ V50), N53 (= N52), T85 (≠ H83), V86 (≠ I84), T118 (= T112), G119 (= G113), C144 (= C138), G286 (= G284), D287 (= D285), R294 (= R292), Q295 (= Q293), A296 (= A294), S299 (= S297)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: M125 (≠ L119), G160 (= G152), S164 (≠ T156), R184 (= R176), K185 (≠ R177), R189 (= R181), I247 (= I242)
3itjB Crystal structure of saccharomyces cerevisiae thioredoxin reductase 1 (trr1) (see paper)
46% identity, 96% coverage: 6:312/319 of query aligns to 3:315/319 of 3itjB
- active site: C142 (= C135), C145 (= C138), D146 (= D139)
- binding flavin-adenine dinucleotide: I9 (≠ L12), G10 (= G13), S11 (= S14), G12 (= G15), P13 (= P16), A14 (= A17), Y32 (vs. gap), E33 (vs. gap), G34 (vs. gap), A37 (≠ V35), I40 (≠ L38), A41 (≠ Q39), G44 (= G42), Q45 (= Q43), T49 (= T47), I52 (≠ V50), N54 (= N52), T86 (≠ H83), V87 (≠ I84), T119 (= T112), G120 (= G113), W135 (≠ K128), C145 (= C138), G287 (= G284), D288 (= D285), R295 (= R292), Q296 (= Q293), A297 (= A294), S300 (= S297)
7p9eB Chlamydomonas reinhardtii NADPH dependent thioredoxin reductase 1 domain cs mutant (see paper)
46% identity, 95% coverage: 9:312/319 of query aligns to 4:304/316 of 7p9eB
- binding flavin-adenine dinucleotide: G8 (= G13), S9 (= S14), G10 (= G15), P11 (= P16), A12 (= A17), E31 (≠ T36), G32 (= G37), N35 (vs. gap), G36 (vs. gap), G39 (= G42), Q40 (= Q43), L41 (= L44), T44 (= T47), N49 (= N52), D81 (≠ H83), V82 (≠ I84), A109 (= A111), T110 (= T112), W126 (≠ K128), S136 (≠ C138), G276 (= G284), D277 (= D285), R284 (= R292), Q285 (= Q293), A286 (= A294), A289 (≠ S297)
Q70G58 Thioredoxin reductase NTRC; NADPH-dependent thioredoxin reductase C; OsNTRC; EC 1.8.1.9 from Oryza sativa subsp. japonica (Rice) (see 2 papers)
46% identity, 95% coverage: 9:312/319 of query aligns to 72:377/515 of Q70G58
- C203 (= C135) mutation to S: Loss of thioredoxin reductase activity.
- C206 (= C138) mutation to S: Loss of thioredoxin reductase activity.
- A227 (= A157) mutation to G: Reduces activity 30-fold; when associated with E-245 and F-246.
- V245 (≠ H175) mutation to E: Reduces activity 30-fold; when associated with G-227 and F-246.
- R246 (= R176) mutation to F: Reduces activity 30-fold; when associated with G-227 and E-245.
Sites not aligning to the query:
- 440 C→S: Loss of thioredoxin activity.
- 443 C→S: Loss of thioredoxin activity.
5w4cA Crystal structure of thioredoxin reductase from cryptococcus neoformans in complex with fad (fo conformation)
44% identity, 99% coverage: 1:315/319 of query aligns to 12:333/356 of 5w4cA
- binding calcium ion: E99 (≠ D82), E116 (vs. gap), E118 (vs. gap)
- binding flavin-adenine dinucleotide: I23 (≠ L12), G24 (= G13), S25 (= S14), P27 (= P16), G28 (≠ A17), Y46 (vs. gap), G48 (vs. gap), A51 (≠ V35), F54 (≠ L38), G58 (= G42), Q59 (= Q43), L60 (= L44), T63 (= T47), N68 (= N52), V101 (≠ I84), T134 (= T112), G135 (= G113), G302 (= G284), D303 (= D285), R310 (= R292), Q311 (= Q293), A312 (= A294), S315 (= S297)
Sites not aligning to the query:
5m5jB Thioredoxin reductase from giardia duodenalis (see paper)
47% identity, 98% coverage: 3:315/319 of query aligns to 1:311/312 of 5m5jB
- active site: C135 (= C135), C138 (= C138), D139 (= D139), D155 (≠ N155), E159 (= E159)
- binding flavin-adenine dinucleotide: G11 (= G13), G12 (≠ S14), G13 (= G15), P14 (= P16), A15 (= A17), V34 (≠ T36), H38 (≠ Q40), T39 (≠ G41), S40 (≠ G42), Q41 (= Q43), M42 (≠ L44), N50 (= N52), D81 (≠ H83), V82 (≠ I84), A111 (= A111), T112 (= T112), G113 (= G113), G280 (= G284), D281 (= D285), R288 (= R292), Q289 (= Q293), A290 (= A294), A293 (≠ S297)
Query Sequence
>N515DRAFT_1348 FitnessBrowser__Dyella79:N515DRAFT_1348
MSTPKHSRLLILGSGPAGYTAAVYAARANLKPTLVTGLQQGGQLMTTTDVENWPGDKAVQ
GPELMQRLAEHAEHFETEMVFDHIHSADLGQRPFRLKGDSGEYTADALVIATGATAKYLG
IESEQHFKGKGVSACATCDGFFFRGQEVVVVGGGNTAVEEALYLSNLCSKVTLVHRRDKL
RAEKIMQDKLFEKAAAGKIELVWNHTVAEVLGDNSGVTGVRVKDVNSGATRDIQATGFFV
AIGHTPNTGIFEGQLDMHDGYIKIHSGQEGMATMTSVPGVFAAGDVADHVYRQAITSAGF
GCMAALDAERWLDQQTPVV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory