Comparing N515DRAFT_1367 FitnessBrowser__Dyella79:N515DRAFT_1367 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
33% identity, 39% coverage: 63:232/437 of query aligns to 47:201/403 of P77589
Sites not aligning to the query:
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
29% identity, 33% coverage: 91:234/437 of query aligns to 82:211/452 of Q5EXK5
Sites not aligning to the query:
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
25% identity, 37% coverage: 18:179/437 of query aligns to 34:196/583 of Q9Y7Q9
Sites not aligning to the query:
>N515DRAFT_1367 FitnessBrowser__Dyella79:N515DRAFT_1367
MTQAAPSVSPLDSSAPRLNRNDLRTLALAALGGALEFYDFVVFVFFTKALGQLFFPADMP
EWLAQVQVYGIFAAGYLARPLGGIVMAHFGDRTGRKRMFTLSVFLMALPTLCIGLLPTYA
QLGVFAPMLLLLLRVVQGVAIGGEVPGAWVFVAEHAPPGRVGFACASLTSGLTAGILIGS
LVAAGVTGMGAEKMLAYGWRLPFILGGVFGFFAVWLRRWLSETPVFAELRERKELASELP
LKRVMTGHLGGVLLSMLVTWMLTAAVVVVILMTPTLVQSSFHLPQKLAFHGNSLAALMLC
FGCIAGGVAVDRFGRGWSLLVGSVALLVTTYLLYRDLGQGAEHFMLLYALAGLCVGVVGV
VPAVMVAAFPPAVRFSGLSFSYNIAYAVFGAITPPLIAYLAAKLGPMAPAHYVAVTAAIG
VLCAVYLLTTRREFHER
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory