SitesBLAST
Comparing N515DRAFT_1372 FitnessBrowser__Dyella79:N515DRAFT_1372 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P31120 Phosphoglucosamine mutase; EC 5.4.2.10 from Escherichia coli (strain K12) (see 3 papers)
57% identity, 99% coverage: 1:445/450 of query aligns to 1:444/445 of P31120
- M1 (= M1) modified: Initiator methionine, Removed
- S100 (= S103) mutation to A: 2% of wild-type activity.; mutation to T: 20-fold increase in the non-specific phosphoglucomutase activity towards glucose-phosphate substrates (non aminated).
- S102 (= S105) active site, Phosphoserine intermediate; modified: Phosphoserine; by autocatalysis; mutation to A: Loss of activity in the absence or presence of glucosamine-1,6-diP.
7omlA Bacillus subtilis phosphoglucomutase glmm (metal bound) (see paper)
45% identity, 98% coverage: 5:445/450 of query aligns to 2:442/445 of 7omlA
7ojrA Bacillus subtilis phosphoglucomutase glmm (phosphate bound) (see paper)
45% identity, 98% coverage: 5:445/450 of query aligns to 2:442/445 of 7ojrA
3i3wA Structure of a phosphoglucosamine mutase from francisella tularensis
41% identity, 98% coverage: 5:444/450 of query aligns to 1:437/441 of 3i3wA
- active site: R9 (= R13), S99 (= S105), H100 (= H106), K109 (= K115), D237 (= D245), D239 (= D247), D241 (= D249), R242 (= R250), H324 (= H333)
- binding zinc ion: S99 (= S105), D237 (= D245), D239 (= D247), D241 (= D249)
1wqaA Crystal structure of pyrococcus horikoshii phosphomannomutase/phosphoglucomutase complexed with mg2+
33% identity, 94% coverage: 5:426/450 of query aligns to 3:433/455 of 1wqaA
- active site: R11 (= R13), S101 (= S105), H102 (= H106), K111 (= K115), D243 (= D245), D245 (= D247), D247 (= D249), R248 (= R250), G330 (≠ H333), R340 (≠ G343)
- binding magnesium ion: S101 (= S105), D243 (= D245), D245 (= D247), D247 (= D249)
P26276 Phosphomannomutase/phosphoglucomutase; PMM / PGM; EC 5.4.2.2; EC 5.4.2.8 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 10 papers)
29% identity, 94% coverage: 12:435/450 of query aligns to 19:444/463 of P26276
- R20 (= R13) mutation to A: No phosphoglucomutase activity.
- S108 (= S105) binding via phosphate group; modified: Phosphoserine; mutation S->A,V: About 5% activity, still subject to substrate inhibition and requires G1,6P as an activator; phosphorylation occurs at a different site.; mutation to C: KM for G1P unchanged, kcat decreases 24-fold; G1,6P stimulates reaction by 2-3 orders of magnitude. No stable protein phosphorylation detected, altered ligation of metal residue.
- N110 (= N107) mutation to A: KM halves, decreases processivity as dissociation of G1,6P intermediate increases 30-fold.
- D242 (= D245) binding
- D244 (= D247) binding
- D246 (= D249) binding
- R247 (= R250) mutation to A: Small reduction in KM, small increase in dissociation of G1,6P intermediate.
- R262 (≠ D265) mutation to A: Increases KM 2-fold, decreases kcat 9-fold for G1P. Alters flexibility of the hinge region.
- K285 (vs. gap) binding
- H308 (≠ V303) binding ; binding
- E325 (= E329) mutation to A: Reduces KM and Vmax approximately 2-fold.
- EMSGH 325:329 (≠ ETSGH 329:333) binding ; binding
- H329 (= H333) mutation to A: No phosphoglucomutase activity using G1P as substrate, protein is less easily phosphorylated, no significant change in structure.
- P368 (≠ Q366) mutation to G: Increases KM 2-fold, decreases kcat 6-fold for G1P. Alters flexibility of the hinge region, structure is less compact.
- R421 (= R412) mutation to C: Loss of phosphomannomutase activity, very low phosphoglucomutase activity.
- RASNT 421:425 (≠ RASGT 412:416) binding ; binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 15 R→A: KM halves, decreases processivity as dissociation of G1,6P intermediate increases 25-fold.
- 17 binding ; binding
Q02E40 Phosphomannomutase/phosphoglucomutase; PMM / PGM; EC 5.4.2.2; EC 5.4.2.8 from Pseudomonas aeruginosa (strain UCBPP-PA14) (see paper)
29% identity, 94% coverage: 12:435/450 of query aligns to 19:444/463 of Q02E40
- S108 (= S105) active site, Non-phosphorylated intermediate; modified: Phosphoserine
1pcjX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
29% identity, 94% coverage: 12:435/450 of query aligns to 14:439/458 of 1pcjX
- active site: R15 (= R13), S103 (= S105), H104 (= H106), K113 (= K115), D237 (= D245), D239 (= D247), D241 (= D249), R242 (= R250), H324 (= H333), D335 (≠ G343)
- binding 1-O-phosphono-alpha-D-mannopyranose: S103 (= S105), T301 (≠ L301), G302 (≠ D302), E320 (= E329), S322 (= S331), H324 (= H333), R416 (= R412), S418 (= S414), N419 (≠ G415), T420 (= T416)
- binding zinc ion: S103 (= S105), D237 (= D245), D239 (= D247), D241 (= D249)
Sites not aligning to the query:
2h5aX Complex of the enzyme pmm/pgm with xylose 1-phosphate (see paper)
29% identity, 94% coverage: 12:435/450 of query aligns to 11:436/455 of 2h5aX
- active site: H101 (= H106), D234 (= D245), D236 (= D247), D238 (= D249), R239 (= R250), D332 (≠ G343)
- binding 1-O-phosphono-alpha-D-xylopyranose: T298 (≠ L301), G299 (≠ D302), H300 (≠ V303), E317 (= E329), S319 (= S331), H321 (= H333), R413 (= R412), S415 (= S414), N416 (≠ G415), T417 (= T416)
- binding zinc ion: S100 (= S105), D234 (= D245), D236 (= D247), D238 (= D249)
Sites not aligning to the query:
2h4lX Complex of pmm/pgm with ribose 1-phosphate (see paper)
29% identity, 94% coverage: 12:435/450 of query aligns to 11:436/455 of 2h4lX
- active site: H101 (= H106), D234 (= D245), D236 (= D247), D238 (= D249), R239 (= R250), D332 (≠ G343)
- binding 1-O-phosphono-alpha-D-ribofuranose: R12 (= R13), S100 (= S105), T298 (≠ L301), E317 (= E329), R413 (= R412), S415 (= S414), N416 (≠ G415), T417 (= T416)
- binding zinc ion: S100 (= S105), D234 (= D245), D236 (= D247), D238 (= D249)
Sites not aligning to the query:
2fkfA Phosphomannomutase/phosphoglucomutase from pseudomonas aeruginosa with alpha-d-glucose 1,6-bisphosphate bound (see paper)
29% identity, 94% coverage: 12:435/450 of query aligns to 11:436/455 of 2fkfA
- active site: R12 (= R13), S100 (= S105), H101 (= H106), K110 (= K115), D234 (= D245), D236 (= D247), D238 (= D249), R239 (= R250), H321 (= H333), D332 (≠ G343)
- binding 1,6-di-O-phosphono-alpha-D-glucopyranose: H101 (= H106), S319 (= S331), R413 (= R412), S415 (= S414), N416 (≠ G415), T417 (= T416)
- binding zinc ion: S100 (= S105), D234 (= D245), D236 (= D247), D238 (= D249)
Sites not aligning to the query:
1pcmX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
29% identity, 94% coverage: 12:435/450 of query aligns to 11:436/455 of 1pcmX
- active site: R12 (= R13), S100 (= S105), H101 (= H106), K110 (= K115), D234 (= D245), D236 (= D247), D238 (= D249), R239 (= R250), H321 (= H333), D332 (≠ G343)
- binding 6-O-phosphono-alpha-D-mannopyranose: S100 (= S105), T298 (≠ L301), G299 (≠ D302), H300 (≠ V303), E317 (= E329), S319 (= S331), H321 (= H333), R413 (= R412), S415 (= S414)
- binding zinc ion: S100 (= S105), D234 (= D245), D236 (= D247), D238 (= D249)
Sites not aligning to the query:
1p5gX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
29% identity, 94% coverage: 12:435/450 of query aligns to 11:436/455 of 1p5gX
- active site: R12 (= R13), S100 (= S105), H101 (= H106), K110 (= K115), D234 (= D245), D236 (= D247), D238 (= D249), R239 (= R250), H321 (= H333), D332 (≠ G343)
- binding 6-O-phosphono-alpha-D-glucopyranose: S100 (= S105), K277 (vs. gap), G299 (≠ D302), H300 (≠ V303), E317 (= E329), S319 (= S331), H321 (= H333), R413 (= R412), S415 (= S414), N416 (≠ G415), T417 (= T416)
- binding zinc ion: S100 (= S105), D234 (= D245), D236 (= D247), D238 (= D249)
Sites not aligning to the query:
1p5dX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
29% identity, 94% coverage: 12:435/450 of query aligns to 11:436/455 of 1p5dX
- active site: R12 (= R13), S100 (= S105), H101 (= H106), K110 (= K115), D234 (= D245), D236 (= D247), D238 (= D249), R239 (= R250), H321 (= H333), D332 (≠ G343)
- binding 1-O-phosphono-alpha-D-glucopyranose: S100 (= S105), R239 (= R250), T298 (≠ L301), G299 (≠ D302), H300 (≠ V303), E317 (= E329), S319 (= S331), H321 (= H333), R413 (= R412), S415 (= S414), T417 (= T416)
- binding zinc ion: S100 (= S105), D234 (= D245), D236 (= D247), D238 (= D249)
Sites not aligning to the query:
1k2yX Crystal structure of phosphomannomutase/phosphoglucomutase s108a mutant from p. Aeruginosa (see paper)
29% identity, 94% coverage: 12:435/450 of query aligns to 15:440/459 of 1k2yX
4il8A Crystal structure of an h329a mutant of p. Aeruginosa pmm/pgm (see paper)
29% identity, 94% coverage: 12:435/450 of query aligns to 15:440/459 of 4il8A
- active site: R16 (= R13), S104 (= S105), H105 (= H106), K114 (= K115), D238 (= D245), D240 (= D247), D242 (= D249), R243 (= R250), A325 (≠ H333), D336 (≠ G343)
- binding magnesium ion: S104 (= S105), D238 (= D245), D240 (= D247), D242 (= D249)
6nqhA Xanthomonas citri dephospho-pgm in complex with xylose-1-phosphate
29% identity, 92% coverage: 29:444/450 of query aligns to 23:447/448 of 6nqhA
- active site: S97 (= S105), H98 (= H106), K107 (= K115), D237 (= D245), D239 (= D247), D241 (= D249), R242 (= R250), H324 (= H333)
- binding magnesium ion: D237 (= D245), D239 (= D247), D241 (= D249)
- binding 1-O-phosphono-alpha-D-xylopyranose: S97 (= S105), H98 (= H106), K107 (= K115), D239 (= D247), R242 (= R250), R280 (≠ M289), S301 (≠ V310), G302 (= G311), E320 (= E329), S322 (= S331), H324 (= H333), R414 (= R412), S416 (= S414), N417 (≠ G415), T418 (= T416), R423 (= R421)
Sites not aligning to the query:
6np8A Xanthomonas citri phospho-pgm in complex with mannose-6-phosphate (see paper)
29% identity, 92% coverage: 29:444/450 of query aligns to 23:447/448 of 6np8A
- active site: S97 (= S105), H98 (= H106), K107 (= K115), D237 (= D245), D239 (= D247), D241 (= D249), R242 (= R250), H324 (= H333)
- binding calcium ion: S97 (= S105), D237 (= D245), D239 (= D247), D241 (= D249)
- binding 6-O-phosphono-alpha-D-mannopyranose: R280 (≠ M289), G302 (= G311), H303 (≠ D312), E320 (= E329), S322 (= S331), H324 (= H333), R414 (= R412), S416 (= S414), N417 (≠ G415), T418 (= T416), R423 (= R421)
Sites not aligning to the query:
6nolA Xanthomonas citri dephospho-pgm in complex with mannose-1-phosphate (see paper)
29% identity, 92% coverage: 29:444/450 of query aligns to 23:447/448 of 6nolA
- active site: S97 (= S105), H98 (= H106), K107 (= K115), D237 (= D245), D239 (= D247), D241 (= D249), R242 (= R250), H324 (= H333)
- binding 1-O-phosphono-alpha-D-mannopyranose: G302 (= G311), E320 (= E329), S322 (= S331), H324 (= H333), R414 (= R412), S416 (= S414), N417 (≠ G415), T418 (= T416), R423 (= R421)
- binding magnesium ion: S97 (= S105), D237 (= D245), D239 (= D247), D241 (= D249)
Sites not aligning to the query:
6nnpA Xanthomonas citri dephospho-pgm in complex with glucose-6-phosphate (see paper)
29% identity, 92% coverage: 29:444/450 of query aligns to 23:447/448 of 6nnpA
- active site: S97 (= S105), H98 (= H106), K107 (= K115), D237 (= D245), D239 (= D247), D241 (= D249), R242 (= R250), H324 (= H333)
- binding 6-O-phosphono-alpha-D-glucopyranose: R280 (≠ M289), G302 (= G311), H303 (≠ D312), E320 (= E329), H324 (= H333), R414 (= R412), S416 (= S414), N417 (≠ G415), T418 (= T416), R423 (= R421)
- binding magnesium ion: S97 (= S105), D237 (= D245), D239 (= D247), D241 (= D249)
Sites not aligning to the query:
Query Sequence
>N515DRAFT_1372 FitnessBrowser__Dyella79:N515DRAFT_1372
MSERKYFGTDGIRGPVGQWPISADFMLRLGRAAGMALARDTREGRPKVLIGKDTRVSGYM
FEAALEAGLVAAGVDVGLLGPMPTPAVAFLTRSLRAQAGIVISASHNPHQDNGIKFFSAI
GEKLSDDVEAAIELGLDAEFTTEAPERLGKASRIDDAGGRYIEFCKRTLVDSEFTLRGLR
IVLDCANGATYQVAPKVFAELGAEVIAIGHKPDGFNINRGVGSTHPQTLQLAVLEHHADI
GIAFDGDGDRVQLVDREGVLADGDDMLFILARAWAAQGRLKGPVVGTLMSNYGLQQALAA
LDVDLIRANVGDRYVLQKLKEHGGQLGGETSGHILCLDRATTGDGIVSALAVLEALGGRD
LAEARQGLYKMPQIMINVRANGARESLHSDEVKQALAETEEALRGRGRVVLRASGTEPLV
RVTVEAADEAEVRRMAEQLAEVVKSAAERS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory