Comparing N515DRAFT_1431 FitnessBrowser__Dyella79:N515DRAFT_1431 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
P0A9J8 Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 from Escherichia coli (strain K12)
29% identity, 96% coverage: 11:358/362 of query aligns to 10:376/386 of P0A9J8
3mwbA The crystal structure of prephenate dehydratase in complex with l-phe from arthrobacter aurescens to 2.0a
37% identity, 72% coverage: 97:357/362 of query aligns to 5:274/306 of 3mwbA
3mwbB The crystal structure of prephenate dehydratase in complex with l-phe from arthrobacter aurescens to 2.0a
36% identity, 72% coverage: 97:357/362 of query aligns to 5:271/303 of 3mwbB
2qmxA The crystal structure of l-phe inhibited prephenate dehydratase from chlorobium tepidum tls (see paper)
31% identity, 74% coverage: 95:362/362 of query aligns to 4:278/278 of 2qmxA
6vh5D Crystal structure of prephenate dehydratase from brucella melitensis biovar abortus 2308 in complex with phenylalanine
31% identity, 73% coverage: 94:357/362 of query aligns to 8:276/282 of 6vh5D
7am0B Gqqa- a novel type of quorum quenching acylases (see paper)
30% identity, 73% coverage: 95:360/362 of query aligns to 4:272/278 of 7am0B
7alzA Gqqa- a novel type of quorum quenching acylases (see paper)
36% identity, 29% coverage: 256:360/362 of query aligns to 81:188/194 of 7alzA
3luyA Putative chorismate mutase from bifidobacterium adolescentis
25% identity, 73% coverage: 94:358/362 of query aligns to 5:284/326 of 3luyA
3nvtA 1.95 angstrom crystal structure of a bifunctional 3-deoxy-7- phosphoheptulonate synthase/chorismate mutase (aroa) from listeria monocytogenes egd-e (see paper)
30% identity, 33% coverage: 10:129/362 of query aligns to 1:109/345 of 3nvtA
Sites not aligning to the query:
5j6fA Crystal structure of dah7ps-cm complex from geobacillus sp. With prephenate (see paper)
32% identity, 27% coverage: 8:106/362 of query aligns to 4:106/352 of 5j6fA
Sites not aligning to the query:
3tfcA 1.95 angstrom crystal structure of a bifunctional 3-deoxy-7- phosphoheptulonate synthase/chorismate mutase (aroa) from listeria monocytogenes egd-e in complex with phosphoenolpyruvate (see paper)
29% identity, 33% coverage: 11:129/362 of query aligns to 1:108/343 of 3tfcA
Sites not aligning to the query:
P39912 Protein AroA(G); EC 2.5.1.54; EC 5.4.99.5 from Bacillus subtilis (strain 168) (see paper)
30% identity, 22% coverage: 8:87/362 of query aligns to 6:83/358 of P39912
Sites not aligning to the query:
5gmuB Crystal structure of chorismate mutase like domain of bifunctional dahp synthase of bacillus subtilis in complex with chlorogenic acid (see paper)
29% identity, 23% coverage: 8:91/362 of query aligns to 5:86/87 of 5gmuB
5jk5A Phenylalanine hydroxylase from dictyostelium - bh2 complex
45% identity, 12% coverage: 287:328/362 of query aligns to 15:56/400 of 5jk5A
Sites not aligning to the query:
5jk8A Phenylalanine hydroxylase from dictyostelium - bh2, norleucine complex
45% identity, 12% coverage: 287:328/362 of query aligns to 15:56/390 of 5jk8A
Sites not aligning to the query:
>N515DRAFT_1431 FitnessBrowser__Dyella79:N515DRAFT_1431
MTEPKASLEQVRERIDSIDRQIQELISERAGWAQEVARVKGAGLSAIDYYRPEREAHVLR
MVVDRNRGPLSDTEMVRLFREIMSSCLAQEDPLKVGFLGPEGTFSEQAVRKHFGHAAYGL
PLGSIEEVFQEVAAGHADFGVVPVENSGQGMIQITLDMFLTSEATICGEIELRVHQCLHS
QGGRMEDIKRVYAHAQSLQQCKTWLRINLPDVECIAVSSNAEAARMARHADDAAAIAGET
AGRVYGLKTLATGIEDRADNTTRFLVIGRSLFPPSGNDRTSLLITVNDKPGALYDVLSPF
AKHDVSLNRIESRPAHTGKWQYAFFIDVSGHVQDAPIQAAMQEMGGAAAQVRVLGSYPVA
LP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory