SitesBLAST
Comparing N515DRAFT_1432 FitnessBrowser__Dyella79:N515DRAFT_1432 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q83E11 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
53% identity, 99% coverage: 4:431/434 of query aligns to 1:429/438 of Q83E11
- KS 21:22 (= KS 24:25) binding
- R26 (= R29) binding
- NSGT 93:96 (≠ NAGT 95:98) Phosphoenolpyruvate
- R123 (= R125) binding
- D315 (= D317) active site, Proton acceptor
- K342 (= K344) binding
- R346 (= R348) binding
- R387 (= R389) binding
3slhD 1.70 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with shikimate-3-phosphate and glyphosate
53% identity, 99% coverage: 4:431/434 of query aligns to 3:431/440 of 3slhD
- active site: K23 (= K24), S24 (= S25), D50 (= D51), N95 (= N95), R125 (= R125), D317 (= D317), E345 (= E345), H388 (= H388), R389 (= R389), T415 (= T415)
- binding glyphosate: K23 (= K24), G97 (= G97), T98 (= T98), R125 (= R125), Q171 (= Q171), D317 (= D317), E345 (= E345), R348 (= R348), H388 (= H388), R389 (= R389)
- binding shikimate-3-phosphate: S24 (= S25), R28 (= R29), S169 (= S169), Q171 (= Q171), R196 (= R196), D317 (= D317), K344 (= K344)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S24 (= S25), R28 (= R29), T98 (= T98), Q171 (= Q171), R196 (= R196), D317 (= D317), K344 (= K344)
4egrA 2.50 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with phosphoenolpyruvate
53% identity, 99% coverage: 4:431/434 of query aligns to 3:427/434 of 4egrA
- active site: K23 (= K24), S24 (= S25), D50 (= D51), N95 (= N95), R125 (= R125), D313 (= D317), E341 (= E345), H384 (= H388), R385 (= R389), T411 (= T415)
- binding phosphoenolpyruvate: K23 (= K24), G97 (= G97), T98 (= T98), R125 (= R125), D313 (= D317), E341 (= E345), R344 (= R348), R385 (= R389)
2pqcA Cp4 epsps liganded with (r)-phosphonate tetrahedral reaction intermediate analog (see paper)
48% identity, 97% coverage: 8:428/434 of query aligns to 2:439/445 of 2pqcA
- active site: K23 (= K24), S24 (= S25), D50 (= D51), N93 (= N95), R123 (= R125), D321 (= D317), E349 (= E345), H399 (= H388), R400 (= R389), T426 (= T415)
- binding [3r-[3a,4a,5b(r*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K23 (= K24), S24 (= S25), R28 (= R29), T96 (= T98), R123 (= R125), S168 (= S169), Q170 (= Q171), D321 (= D317), K348 (= K344), E349 (= E345), R352 (= R348), R400 (= R389)
2pqbA Cp4 epsps liganded with (r)-difluoromethyl tetrahedral intermediate analog (see paper)
48% identity, 97% coverage: 8:428/434 of query aligns to 2:439/445 of 2pqbA
- active site: K23 (= K24), S24 (= S25), D50 (= D51), N93 (= N95), R123 (= R125), D321 (= D317), E349 (= E345), H399 (= H388), R400 (= R389), T426 (= T415)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K23 (= K24), S24 (= S25), R28 (= R29), A95 (≠ G97), T96 (= T98), R123 (= R125), S168 (= S169), Q170 (= Q171), D321 (= D317), K348 (= K344), E349 (= E345), R352 (= R348), R400 (= R389)
2ggaA Cp4 epsp synthase liganded with s3p and glyphosate (see paper)
48% identity, 97% coverage: 8:428/434 of query aligns to 2:439/445 of 2ggaA
- active site: K23 (= K24), S24 (= S25), D50 (= D51), N93 (= N95), R123 (= R125), D321 (= D317), E349 (= E345), H399 (= H388), R400 (= R389), T426 (= T415)
- binding glyphosate: K23 (= K24), A94 (= A96), A95 (≠ G97), T96 (= T98), R123 (= R125), D321 (= D317), E349 (= E345), R352 (= R348), R400 (= R389)
- binding shikimate-3-phosphate: S24 (= S25), R28 (= R29), S168 (= S169), A169 (= A170), Q170 (= Q171), R195 (= R196), D321 (= D317), K348 (= K344)
2gg6A Cp4 epsp synthase liganded with s3p (see paper)
48% identity, 97% coverage: 8:428/434 of query aligns to 2:439/445 of 2gg6A
- active site: K23 (= K24), S24 (= S25), D50 (= D51), N93 (= N95), R123 (= R125), D321 (= D317), E349 (= E345), H399 (= H388), R400 (= R389), T426 (= T415)
- binding shikimate-3-phosphate: S24 (= S25), R28 (= R29), T96 (= T98), S168 (= S169), Q170 (= Q171), D321 (= D317), K348 (= K344)
Q9R4E4 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Agrobacterium sp. (strain CP4) (see 2 papers)
48% identity, 97% coverage: 8:428/434 of query aligns to 7:444/455 of Q9R4E4
- KS 28:29 (= KS 24:25) binding
- R33 (= R29) binding
- NAAT 98:101 (≠ NAGT 95:98) Phosphoenolpyruvate
- A100 (≠ G97) mutation to G: Confers resistance to glyphosate.
- R128 (= R125) binding
- K353 (= K344) binding
- R357 (= R348) binding
- R405 (= R389) binding
Q9S400 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) (see paper)
45% identity, 96% coverage: 7:422/434 of query aligns to 3:419/427 of Q9S400
1rf6A Structural studies of streptococcus pneumoniae epsp synthase in s3p- glp bound state (see paper)
45% identity, 96% coverage: 7:422/434 of query aligns to 3:419/427 of 1rf6A
- active site: K20 (= K24), S21 (= S25), D47 (= D51), N90 (= N95), D115 (≠ E120), R120 (= R125), D312 (= D317), E340 (= E345), H384 (= H388), R385 (= R389), T412 (= T415)
- binding glyphosate: K20 (= K24), G92 (= G97), T93 (= T98), R120 (= R125), Q168 (= Q171), D312 (= D317), E340 (= E345), R343 (= R348), H384 (= H388), R385 (= R389)
- binding shikimate-3-phosphate: S21 (= S25), R25 (= R29), S166 (= S169), Q168 (= Q171), R193 (= R196), I311 (= I316), D312 (= D317), K339 (= K344)
1rf4A Structural studies of streptococcus pneumoniae epsp synthase, tetrahedral intermediate bound state (see paper)
45% identity, 96% coverage: 7:422/434 of query aligns to 3:419/427 of 1rf4A
- active site: K20 (= K24), S21 (= S25), D47 (= D51), N90 (= N95), D115 (≠ E120), R120 (= R125), D312 (= D317), E340 (= E345), H384 (= H388), R385 (= R389), T412 (= T415)
- binding (3r,4s,5r)-5-{[(1r)-1-carboxy-2-fluoro-1-(phosphonooxy)ethyl]oxy}-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K20 (= K24), S21 (= S25), R25 (= R29), G92 (= G97), T93 (= T98), R120 (= R125), S166 (= S169), A167 (= A170), Q168 (= Q171), R193 (= R196), D312 (= D317), K339 (= K344), E340 (= E345), R343 (= R348), H384 (= H388), R385 (= R389)
3nvsA 1.02 angstrom resolution crystal structure of 3-phosphoshikimate 1- carboxyvinyltransferase from vibrio cholerae in complex with shikimate-3-phosphate (partially photolyzed) and glyphosate
33% identity, 95% coverage: 9:422/434 of query aligns to 7:419/426 of 3nvsA
- active site: K22 (= K24), S23 (= S25), D49 (= D51), N94 (= N95), P119 (≠ E120), R124 (= R125), H128 (≠ R129), Q135 (≠ A136), Y142 (≠ T143), E144 (vs. gap), A247 (= A239), A255 (≠ S247), D314 (= D314), E342 (= E345), H386 (= H388), R387 (= R389), K412 (≠ T415)
- binding glyphosate: K22 (= K24), G96 (= G97), R124 (= R125), Q172 (= Q171), D314 (= D314), E342 (= E345), R345 (= R348), H386 (= H388), R387 (= R389)
- binding magnesium ion: E123 (≠ K124), Q145 (= Q144)
- binding shikimate-3-phosphate: K22 (= K24), S23 (= S25), R27 (= R29), T97 (= T98), S170 (= S169), S171 (≠ A170), Q172 (= Q171), S198 (≠ P192), Y201 (≠ T195), D314 (= D314), N337 (≠ E340), K341 (= K344)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S23 (= S25), R27 (= R29), Q172 (= Q171), Y201 (≠ T195), D314 (= D314), K341 (= K344)
Q9KRB0 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
33% identity, 95% coverage: 9:422/434 of query aligns to 7:419/426 of Q9KRB0
7tm6A Crystal structure of shikimate-3-phosphate and glyphosate bound 3- phosphoshikimate 1-carboxyvinyltransferase from klebsiella pneumoniae
31% identity, 95% coverage: 9:422/434 of query aligns to 6:417/426 of 7tm6A
- binding glyphosate: K21 (= K24), G95 (= G97), R123 (= R125), Q170 (≠ A170), D312 (= D314), E340 (= E345), R343 (= R348), H384 (= H388), R385 (= R389)
- binding shikimate-3-phosphate: S22 (= S25), R26 (= R29), T96 (= T98), S168 (≠ A168), S169 (= S169), Q170 (≠ A170), S196 (≠ P192), Y199 (≠ T195), D312 (= D314), N335 (≠ E340), K339 (= K344)
7tm5B Crystal structure of shikimate-3-phosphate bound 3-phosphoshikimate 1- carboxyvinyltransferase from klebsiella pneumoniae
31% identity, 95% coverage: 9:422/434 of query aligns to 7:418/427 of 7tm5B
- binding shikimate-3-phosphate: K22 (= K24), S23 (= S25), R27 (= R29), S169 (≠ A168), S170 (= S169), Q171 (≠ A170), S197 (≠ P192), Y200 (≠ T195), D313 (= D314), N336 (≠ E340), K340 (= K344)
P11043 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EC 2.5.1.19 from Petunia hybrida (Petunia) (see paper)
30% identity, 96% coverage: 9:423/434 of query aligns to 80:509/516 of P11043
- G173 (= G97) mutation to A: Resistance to glyphosate due to a lower affinity. Slight reduction in EPSP synthase activity.
2pq9A E. Coli epsps liganded with (r)-difluoromethyl tetrahedral reaction intermediate analog (see paper)
31% identity, 95% coverage: 9:422/434 of query aligns to 7:418/427 of 2pq9A
- active site: K22 (= K24), S23 (= S25), D49 (= D51), N94 (= N95), P119 (≠ E120), R124 (= R125), D313 (= D314), E341 (= E345), H385 (= H388), R386 (= R389), K411 (≠ T415)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K22 (= K24), S23 (= S25), R27 (= R29), G96 (= G97), T97 (= T98), R124 (= R125), S169 (= S169), S170 (≠ A170), Q171 (= Q171), S197 (≠ P192), Y200 (≠ T195), D313 (= D314), N336 (≠ E340), K340 (= K344), R344 (= R348), H385 (= H388), R386 (= R389), K411 (≠ T415)
2aa9A Epsp synthase liganded with shikimate (see paper)
31% identity, 95% coverage: 9:422/434 of query aligns to 7:418/427 of 2aa9A
- active site: K22 (= K24), S23 (= S25), D49 (= D51), N94 (= N95), P119 (≠ E120), R124 (= R125), D313 (= D314), E341 (= E345), H385 (= H388), R386 (= R389), K411 (≠ T415)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: K22 (= K24), S23 (= S25), R27 (= R29), T97 (= T98), Q171 (= Q171), Y200 (≠ T195), D313 (= D314), K340 (= K344)
1x8tA Epsps liganded with the (r)-phosphonate analog of the tetrahedral reaction intermediate (see paper)
31% identity, 95% coverage: 9:422/434 of query aligns to 7:418/427 of 1x8tA
- active site: K22 (= K24), S23 (= S25), D49 (= D51), N94 (= N95), P119 (≠ E120), R124 (= R125), D313 (= D314), E341 (= E345), H385 (= H388), R386 (= R389), K411 (≠ T415)
- binding [3r-[3a,4a,5b(r*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K22 (= K24), S23 (= S25), R27 (= R29), T97 (= T98), S169 (= S169), S170 (≠ A170), Q171 (= Q171), S197 (≠ P192), Y200 (≠ T195), D313 (= D314), N336 (≠ E340), K340 (= K344), R344 (= R348), H385 (= H388), R386 (= R389)
1x8rA Epsps liganded with the (s)-phosphonate analog of the tetrahedral reaction intermediate (see paper)
31% identity, 95% coverage: 9:422/434 of query aligns to 7:418/427 of 1x8rA
- active site: K22 (= K24), S23 (= S25), D49 (= D51), N94 (= N95), P119 (≠ E120), R124 (= R125), D313 (= D314), E341 (= E345), H385 (= H388), R386 (= R389), K411 (≠ T415)
- binding [3r-[3a,4a,5b(s*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K22 (= K24), S23 (= S25), R27 (= R29), G96 (= G97), T97 (= T98), R124 (= R125), S169 (= S169), S170 (≠ A170), Q171 (= Q171), S197 (≠ P192), Y200 (≠ T195), D313 (= D314), N336 (≠ E340), K340 (= K344), E341 (= E345), H385 (= H388), K411 (≠ T415)
Query Sequence
>N515DRAFT_1432 FitnessBrowser__Dyella79:N515DRAFT_1432
MTRLDWLSQPARALHGNVRVPGDKSVSHRSMMLSALAEGRSHIRGFLEGEDTRATAAVLQ
KLGVRIETPSEGERIVDGVGLHGLRGTAQALDCGNAGTGMRLLAGLLAGQAFDSTLVGDE
SLSKRPMRRVTEPLAAMGARIDTQDGLPPLRVHGGQPLKGIRYTLPVASAQVKSALLLAG
LYAQGETEVIEPHPTRDYTERMLAAFGWPIEFEPGRARLSGGHRLRATDVEVPADFSSAA
FFLVAGSIVPGAELRLPAVGLNPRRTGLLQALRLMGADIAVENQRESGGEPVGDLIVRHA
PLHGVELPEALVPDMIDEFPALFIAAAVAQGRTVVRGAAELRVKESDRIATMAAGMKAIG
ARIEETPDGAIIEGGALRGGEVDSHGDHRIAMSFAVAGLVAQEPIRIADCANVATSFPGF
MELANGCGFDLHAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory