Comparing N515DRAFT_1536 FitnessBrowser__Dyella79:N515DRAFT_1536 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5h8iC Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with n-(dihydroxymethyl)putrescine (see paper)
41% identity, 97% coverage: 4:291/296 of query aligns to 7:292/301 of 5h8iC
5h8jB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine (see paper)
41% identity, 97% coverage: 4:291/296 of query aligns to 3:288/297 of 5h8jB
5h8lB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant in complex with putrescine (see paper)
41% identity, 97% coverage: 4:291/296 of query aligns to 4:289/298 of 5h8lB
7ovgA The c146a variant of an amidase from pyrococcus horikoshii with bound acetamide (see paper)
35% identity, 91% coverage: 20:287/296 of query aligns to 18:261/263 of 7ovgA
6ypaB The c146a variant of an amidase from pyrococcus horikoshii with bound glutaramide
35% identity, 91% coverage: 20:287/296 of query aligns to 24:267/269 of 6ypaB
Q9NQR4 Omega-amidase NIT2; Nitrilase homolog 2; EC 3.5.1.3 from Homo sapiens (Human) (see 2 papers)
29% identity, 98% coverage: 5:293/296 of query aligns to 3:275/276 of Q9NQR4
3klcB Crystal structure of hyperthermophilic nitrilase (see paper)
33% identity, 91% coverage: 20:287/296 of query aligns to 16:259/261 of 3klcB
Sites not aligning to the query:
3klcA Crystal structure of hyperthermophilic nitrilase (see paper)
33% identity, 91% coverage: 20:287/296 of query aligns to 16:259/261 of 3klcA
Sites not aligning to the query:
Q9UYV8 Nitrilase; PaNit; EC 3.5.5.1 from Pyrococcus abyssi (strain GE5 / Orsay) (see paper)
33% identity, 91% coverage: 20:287/296 of query aligns to 17:260/262 of Q9UYV8
Q9UBR1 Beta-ureidopropionase; BUP-1; Beta-alanine synthase; N-carbamoyl-beta-alanine amidohydrolase; EC 3.5.1.6 from Homo sapiens (Human) (see 4 papers)
30% identity, 89% coverage: 26:288/296 of query aligns to 100:366/384 of Q9UBR1
Sites not aligning to the query:
Q964D8 Beta-ureidopropionase; Beta-alanine synthase; N-carbamoyl-beta-alanine amidohydrolase; EC 3.5.1.6 from Dictyostelium discoideum (Social amoeba)
25% identity, 91% coverage: 26:294/296 of query aligns to 103:375/391 of Q964D8
Sites not aligning to the query:
Q44185 N-carbamoyl-D-amino acid hydrolase; D-N-alpha-carbamilase; EC 3.5.1.77 from Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter) (see paper)
28% identity, 88% coverage: 30:288/296 of query aligns to 32:299/304 of Q44185
8hpcC Crystal structure of c171a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-hydroxyphenylglycine
28% identity, 88% coverage: 30:288/296 of query aligns to 31:298/303 of 8hpcC
1uf8A Crystal structure of c171a/v236a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-phenylalanine
28% identity, 88% coverage: 30:288/296 of query aligns to 31:298/303 of 1uf8A
1uf7A Crystal structure of c171a/v236a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-valine
28% identity, 88% coverage: 30:288/296 of query aligns to 31:298/303 of 1uf7A
1uf5A Crystal structure of c171a/v236a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-methionine
28% identity, 88% coverage: 30:288/296 of query aligns to 31:298/303 of 1uf5A
P46011 Bifunctional nitrilase/nitrile hydratase NIT4; Cyanoalanine nitrilase; Nitrilase 4; EC 3.5.5.1; EC 3.5.5.4; EC 4.2.1.65 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 83% coverage: 21:266/296 of query aligns to 52:308/355 of P46011
4iztA The e41q mutant of the amidase from nesterenkonia sp. An1 showing covalent addition of the acetamide moiety of fluoroacetamide at the active site cysteine
29% identity, 95% coverage: 6:287/296 of query aligns to 10:259/263 of 4iztA
4izuA The e41q mutant of the amidase from nesterenkonia sp. An1 showing the result of michael addition of acrylamide at the active site cysteine
29% identity, 97% coverage: 6:291/296 of query aligns to 2:254/254 of 4izuA
Q94JV5 Deaminated glutathione amidase, chloroplastic/cytosolic; dGSH amidase; Nitrilase-like protein 2; Protein nitrilase 1 homolog; AtNit1; Protein Nit1 homolog; EC 3.5.1.128 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 95% coverage: 3:282/296 of query aligns to 34:302/307 of Q94JV5
Sites not aligning to the query:
>N515DRAFT_1536 FitnessBrowser__Dyella79:N515DRAFT_1536
MTRKTLKVALLQETHRGSRDANLDAIEAGLREAAAAGAELVLLQELHNGPYFCQHESVGE
FDHAETIPGPGTERIGKLAEELKLVVVASLFEKRATGLYHNTAVVFDRSAKIAGKYRKMH
IPDDPAFYEKFYFTPGDLGFDPIDTAVGRLGVLVCWDQWYPEAARLMALAGAELLLYPTA
IGWDPNDEQAEKDRQREAWVTVQRGHAVANGLPLLACNRTGYEPDPSGVGAGIQFWGTSF
VAGPQGEFLGQAGTDGRQLLVVEIDMARSEHVRRIWPFLRDRRIDAYGDLLKRFRD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory