Comparing N515DRAFT_1560 FitnessBrowser__Dyella79:N515DRAFT_1560 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
P68183 Maltose/maltodextrin transport system permease protein MalG from Escherichia coli (strain K12) (see 2 papers)
35% identity, 57% coverage: 52:207/274 of query aligns to 81:229/296 of P68183
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
28% identity, 51% coverage: 55:194/274 of query aligns to 68:210/285 of 7cagA
Sites not aligning to the query:
>N515DRAFT_1560 FitnessBrowser__Dyella79:N515DRAFT_1560
MSRRALPGFGLSLGITLAWLGGIVLLPLTALAWKAASLGPSAWWAHLGTRRVLLALQLSF
GGALVAAVLDLLLGLLLAWVLVRYRFPLRRVCDALIDLPFALPTAVAGIALTALYAPNGW
VGQLLQPLGVQVAYTRLGVLLAMVFVGLPFVVRTLQPVIESLEREVEEAALTLGASPWQS
FRRVLLPLLAPTLLTGFALALARAVGEYGSVIYISGNLPLRTEIVPLLIVQKIDAGDDTA
PAALLGAVMLAVSLLVLLTVNGLQRWSRRWSGVS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory