SitesBLAST
Comparing N515DRAFT_1583 FitnessBrowser__Dyella79:N515DRAFT_1583 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ijrF 2.05 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'Ames ancestor' in complex with NAD+
56% identity, 82% coverage: 58:331/334 of query aligns to 12:285/290 of 3ijrF
- active site: G57 (= G102), S182 (= S227), L192 (= L237), Y195 (= Y240), K199 (= K244), K240 (= K285)
- binding magnesium ion: D55 (= D100), S56 (= S101), E80 (≠ S125)
- binding nicotinamide-adenine-dinucleotide: P21 (= P66), D55 (= D100), S56 (= S101), G57 (= G102), I58 (= I103), Y77 (= Y122), L78 (= L123), E80 (≠ S125), G103 (= G148), D104 (= D149), L105 (≠ V150), N131 (= N176), V132 (≠ A177), A133 (= A178), Q134 (≠ F179), I155 (≠ T200), T180 (= T225), S182 (= S227), Y195 (= Y240), K199 (= K244), P225 (= P270), G226 (= G271), P227 (= P272), I228 (≠ V273), T230 (= T275), L232 (= L277)
3i3oA 2.06 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'Ames ancestor' in complex with NAD-acetone
56% identity, 82% coverage: 58:331/334 of query aligns to 4:277/282 of 3i3oA
- active site: G49 (= G102), S174 (= S227), L184 (= L237), Y187 (= Y240), K191 (= K244), K232 (= K285)
- binding magnesium ion: D47 (= D100), S48 (= S101), E72 (≠ S125)
- binding nicotinamide adenine dinucleotide acetone adduct: G45 (= G98), D47 (= D100), S48 (= S101), G49 (= G102), I50 (= I103), Y69 (= Y122), L70 (= L123), E72 (≠ S125), G95 (= G148), D96 (= D149), L97 (≠ V150), N123 (= N176), V124 (≠ A177), A125 (= A178), Q126 (≠ F179), Q127 (= Q180), I147 (≠ T200), T172 (= T225), S174 (= S227), Y187 (= Y240), K191 (= K244), P217 (= P270), G218 (= G271), I220 (≠ V273), T222 (= T275), L224 (= L277)
5jydB Crystal structure of a putative short chain dehydrogenase from burkholderia cenocepacia
49% identity, 83% coverage: 54:331/334 of query aligns to 10:288/292 of 5jydB
- active site: G58 (= G102), S184 (= S227), L194 (= L237), Y197 (= Y240), K201 (= K244), P242 (≠ A284)
- binding magnesium ion: D56 (= D100), S57 (= S101), E82 (≠ S126)
- binding nicotinamide-adenine-dinucleotide: G54 (= G98), D56 (= D100), S57 (= S101), G58 (= G102), I59 (= I103), L79 (= L123), E82 (≠ S126), D106 (= D149), I107 (≠ V150), N133 (= N176), A134 (= A177), A135 (= A178), T182 (= T225), S184 (= S227), Y197 (= Y240), K201 (= K244), P227 (= P270), G228 (= G271), P229 (= P272), Y230 (≠ V273), T232 (= T275), L234 (= L277), Q235 (vs. gap)
3r3sA Structure of the ygha oxidoreductase from salmonella enterica
41% identity, 82% coverage: 59:331/334 of query aligns to 15:288/292 of 3r3sA
- active site: G58 (= G102), S184 (= S227), L194 (= L237), Y197 (= Y240), K201 (= K244), Q242 (≠ A284)
- binding magnesium ion: D56 (= D100), S57 (= S101), E82 (≠ S126)
- binding nicotinamide-adenine-dinucleotide: D56 (= D100), S57 (= S101), G58 (= G102), I59 (= I103), L79 (= L123), E82 (≠ S126), D106 (= D149), L107 (≠ V150), V133 (≠ N176), A134 (= A177), G135 (≠ A178), S184 (= S227), Y197 (= Y240), K201 (= K244), P227 (= P270), G228 (= G271), I230 (≠ V273), T232 (= T275), L234 (= L277), Q235 (≠ N278)
P0AG84 Uncharacterized oxidoreductase YghA; EC 1.-.-.- from Escherichia coli (strain K12) (see paper)
41% identity, 82% coverage: 59:331/334 of query aligns to 17:290/294 of P0AG84
- K39 (≠ P81) modified: N6-acetyllysine
3ay6B Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose (see paper)
37% identity, 73% coverage: 89:333/334 of query aligns to 11:257/267 of 3ay6B
- active site: G24 (= G102), S151 (= S227), Y164 (= Y240), K168 (= K244)
- binding beta-D-glucopyranose: E102 (≠ Q180), S151 (= S227), H153 (≠ T229), W158 (≠ N234), Y164 (= Y240), N202 (= N278), K205 (≠ Q282)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G98), T23 (≠ S101), G24 (= G102), L25 (≠ I103), Y45 (≠ L123), D71 (= D149), V72 (= V150), N98 (= N176), A99 (= A177), G100 (≠ A178), V101 (≠ F179), M149 (≠ T225), S151 (= S227), Y164 (= Y240), K168 (= K244), P194 (= P270), G195 (= G271), M197 (≠ V273), T199 (= T275), P200 (= P276), I201 (≠ L277), N202 (= N278)
8bcjB Crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 in complex with NADP+
37% identity, 71% coverage: 95:331/334 of query aligns to 8:249/250 of 8bcjB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G98), S13 (≠ D100), R14 (≠ S101), G15 (= G102), I16 (= I103), L36 (= L123), R37 (≠ E124), N38 (≠ S125), A61 (≠ G148), D62 (= D149), V63 (= V150), N89 (= N176), A90 (= A177), G91 (≠ A178), T113 (= T200), V143 (≠ T225), S145 (= S227), Y159 (= Y240), K163 (= K244), P189 (= P270), G190 (= G271), I192 (≠ V273), T194 (= T275), I196 (≠ L277), H197 (≠ N278)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
36% identity, 73% coverage: 88:331/334 of query aligns to 4:241/244 of 4nbuB
- active site: G18 (= G102), N111 (= N201), S139 (= S227), Q149 (≠ L237), Y152 (= Y240), K156 (= K244)
- binding acetoacetyl-coenzyme a: D93 (≠ H182), K98 (≠ D188), S139 (= S227), N146 (= N234), V147 (≠ P235), Q149 (≠ L237), Y152 (= Y240), F184 (≠ P272), M189 (≠ L277), K200 (= K289)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G98), N17 (≠ S101), G18 (= G102), I19 (= I103), D38 (= D127), F39 (≠ D128), V59 (≠ G148), D60 (= D149), V61 (= V150), N87 (= N176), A88 (= A177), G89 (≠ A178), I90 (≠ F179), T137 (= T225), S139 (= S227), Y152 (= Y240), K156 (= K244), P182 (= P270), F184 (≠ P272), T185 (≠ V273), T187 (= T275), M189 (≠ L277)
4iqgD Crystal structure of bpro0239 oxidoreductase from polaromonas sp. Js666 in NADP bound form
37% identity, 71% coverage: 94:331/334 of query aligns to 5:247/248 of 4iqgD
- active site: G13 (= G102), N112 (= N201), S143 (= S227), Y154 (≠ L237), Y157 (= Y240), K161 (= K244)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G98), S11 (≠ D100), R12 (≠ S101), G13 (= G102), I14 (= I103), N32 (≠ V121), A34 (≠ L123), S35 (≠ E124), N36 (≠ S125), A59 (≠ G148), D60 (= D149), V61 (= V150), N87 (= N176), A88 (= A177), G89 (≠ A178), V141 (≠ T225), S143 (= S227), Y157 (= Y240), K161 (= K244), P187 (= P270), G188 (= G271), I190 (≠ V273), T192 (= T275), I194 (≠ L277), H195 (≠ N278)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
37% identity, 73% coverage: 88:331/334 of query aligns to 8:251/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G98), S20 (≠ D100), K21 (≠ S101), G22 (= G102), I23 (= I103), A43 (≠ L123), S44 (≠ E124), S45 (= S125), G68 (= G148), D69 (= D149), V70 (= V150), N96 (= N176), S97 (≠ A177), G98 (≠ A178), Y100 (≠ Q180), I144 (≠ T225), S146 (= S227), Y159 (= Y240), K163 (= K244), P189 (= P270), G190 (= G271), M191 (≠ P272), I192 (≠ V273), T194 (= T275), G196 (vs. gap), T197 (vs. gap)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S227), Y159 (= Y240), M191 (≠ P272), I202 (≠ L277)
4bmsF Short chain alcohol dehydrogenase from ralstonia sp. Dsm 6428 in complex with NADPH
37% identity, 74% coverage: 88:333/334 of query aligns to 3:247/249 of 4bmsF
- active site: S137 (= S227), H147 (≠ L237), Y150 (= Y240), K154 (= K244), Q195 (≠ A280)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G98), N15 (≠ D100), S16 (= S101), I18 (= I103), R38 (≠ E131), R39 (≠ T132), A59 (≠ G148), D60 (= D149), V61 (= V150), N87 (= N176), S88 (≠ A177), G89 (≠ A178), V110 (≠ T200), S137 (= S227), Y150 (= Y240), K154 (= K244), G181 (= G271), I183 (≠ V273), T185 (= T275), I187 (≠ L277)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
36% identity, 71% coverage: 95:331/334 of query aligns to 8:243/246 of 3osuA
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
36% identity, 72% coverage: 94:333/334 of query aligns to 10:253/255 of 5itvA
- active site: G18 (= G102), S141 (= S227), Y154 (= Y240), K158 (= K244)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G98), S17 (= S101), G18 (= G102), I19 (= I103), D38 (≠ Y122), I39 (≠ L123), T61 (≠ G148), I63 (≠ V150), N89 (= N176), G91 (≠ A178), T139 (= T225), S141 (= S227), Y154 (= Y240), K158 (= K244), P184 (= P270), G185 (= G271), I186 (≠ P272), I187 (≠ V273)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
36% identity, 71% coverage: 95:331/334 of query aligns to 5:236/239 of 3sj7A
- active site: G12 (= G102), S138 (= S227), Q148 (≠ L237), Y151 (= Y240), K155 (= K244)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G98), S10 (≠ D100), R11 (≠ S101), I13 (= I103), N31 (≠ V121), Y32 (= Y122), A33 (≠ L123), G34 (≠ E124), S35 (= S125), A58 (≠ G148), N59 (≠ D149), V60 (= V150), N86 (= N176), A87 (= A177), T109 (= T200), S138 (= S227), Y151 (= Y240), K155 (= K244), P181 (= P270), G182 (= G271)
6ihhA Crystal structure of rasadh f12 from ralstonia.Sp in complex with NADPH and a6o
37% identity, 74% coverage: 88:333/334 of query aligns to 3:247/249 of 6ihhA
- binding (2R,3S)-2-ethyl-2-[(2E)-2-(6-methoxy-3,4-dihydro-2H-naphthalen-1-ylidene)ethyl]-3-oxidanyl-cyclopentan-1-one: S137 (= S227), H147 (≠ L237), Y150 (= Y240), L188 (vs. gap), L246 (≠ P332)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G98), N15 (≠ D100), S16 (= S101), G17 (= G102), I18 (= I103), R38 (≠ E131), R39 (≠ T132), D60 (= D149), V61 (= V150), N87 (= N176), S88 (≠ A177), G89 (≠ A178), V110 (≠ T200), T135 (= T225), S137 (= S227), Y150 (= Y240), K154 (= K244), P180 (= P270), G181 (= G271), A182 (≠ P272), I183 (≠ V273), T185 (= T275), S187 (vs. gap)
5wuwA Serratia marcescens short-chain dehydrogenase/reductase f98l/f202l mutant (see paper)
36% identity, 73% coverage: 89:331/334 of query aligns to 3:242/245 of 5wuwA
- active site: G16 (= G102), S140 (= S227), Y154 (= Y240), L161 (≠ I247)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G98), R15 (≠ S101), I17 (= I103), Y36 (= Y122), A37 (≠ L123), A38 (≠ E124), D63 (= D149), S64 (≠ V150), N90 (= N176), A91 (= A177), G92 (≠ A178), Y154 (= Y240), K158 (= K244), G185 (= G271), P186 (= P272), V187 (= V273)
6zt2A 17beta-hydroxysteroid dehydrogenase type 14 variant s205 in complex with 3-chloro-2,6-difluorophenol
35% identity, 66% coverage: 111:331/334 of query aligns to 25:244/252 of 6zt2A
- binding beta-D-glucopyranose: W184 (= W274), T185 (= T275), P186 (= P276), E189 (≠ P279)
- binding nicotinamide-adenine-dinucleotide: D36 (= D127), K37 (≠ D128), D58 (= D149), V59 (= V150), N85 (= N176), L109 (≠ T200), S137 (= S227), Y150 (= Y240), K154 (= K244), P180 (= P270), G181 (= G271), N182 (≠ P272), I183 (≠ V273), T185 (= T275), L187 (= L277)
- binding 3-chloranyl-2,6-bis(fluoranyl)phenol: H89 (≠ Q180), S137 (= S227), Y150 (= Y240), N182 (≠ P272), W188 (≠ N278)
Sites not aligning to the query:
6zdiA 17beta-hydroxysteroid dehydrogenase type 14 variant s205 in complex with 2-fluoro-5-nitrophenol
35% identity, 66% coverage: 111:331/334 of query aligns to 25:244/252 of 6zdiA
- active site: S137 (= S227), Y150 (= Y240), K154 (= K244)
- binding nicotinamide-adenine-dinucleotide: D36 (= D127), K37 (≠ D128), D58 (= D149), V59 (= V150), N85 (= N176), A86 (= A177), L109 (≠ T200), I135 (≠ T225), S137 (= S227), Y150 (= Y240), K154 (= K244), P180 (= P270), G181 (= G271), N182 (≠ P272), I183 (≠ V273), T185 (= T275), L187 (= L277)
- binding 2-fluoranyl-5-nitro-phenol: H89 (≠ Q180), S137 (= S227), Y150 (= Y240), L187 (= L277), W188 (≠ N278), L191 (vs. gap)
Sites not aligning to the query:
6zdeA 17beta-hydroxysteroid dehydrogenase type 14 variant s205 in complex with pentafluorophenol
35% identity, 66% coverage: 111:331/334 of query aligns to 25:244/252 of 6zdeA
- active site: S137 (= S227), Y150 (= Y240), K154 (= K244)
- binding nicotinamide-adenine-dinucleotide: D36 (= D127), K37 (≠ D128), D58 (= D149), V59 (= V150), N85 (= N176), L109 (≠ T200), S137 (= S227), Y150 (= Y240), K154 (= K244), P180 (= P270), G181 (= G271), N182 (≠ P272), I183 (≠ V273), T185 (= T275), L187 (= L277)
- binding 2,3,4,5,6-pentakis(fluoranyl)phenol: H89 (≠ Q180), S137 (= S227), Y150 (= Y240), L187 (= L277), W188 (≠ N278)
Sites not aligning to the query:
6gtuA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with fragment j6
35% identity, 66% coverage: 111:331/334 of query aligns to 26:245/268 of 6gtuA
- active site: S138 (= S227), Y151 (= Y240), K155 (= K244)
- binding N-(1,3-benzodioxol-5-ylmethyl)cyclopentanamine: N183 (≠ P272)
- binding nicotinamide-adenine-dinucleotide: D37 (= D127), K38 (≠ D128), D59 (= D149), N86 (= N176), A87 (= A177), G88 (≠ A178), L110 (≠ T200), S138 (= S227), Y151 (= Y240), K155 (= K244), G182 (= G271), I184 (≠ V273), T186 (= T275), L188 (= L277)
Sites not aligning to the query:
Query Sequence
>N515DRAFT_1583 FitnessBrowser__Dyella79:N515DRAFT_1583
MAVRTRSKATAAADRQRAVQREIDEKDSAKAKSGKSAAAEKSAKPKQATARKQPETPLPE
QHQAKPGKEHQLQPRPHFKAPQYKGSDKLKGMATLITGGDSGIGRAVAVLFAREGADVGI
VYLESSDDAEETRRHVEQEGGRCLLIQGDVTDPDFCQQAVEETVEEFGHLDVLVNNAAFQ
EHADTLEDITEEHMDLTFRTNLYGYFHMARAALPHMKAGASIINTGSETGLFGNPKLLDY
SATKGAIHAFTRSLSANLVKKGIRVNAVAPGPVWTPLNPADQPAKSVAKFGSSNPMGRPA
QPEEVAPAYVFLAAPSCASYISGAILPVMGGPTG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory