SitesBLAST
Comparing N515DRAFT_1702 N515DRAFT_1702 UDP-glucose 4-epimerase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
30% identity, 99% coverage: 4:304/305 of query aligns to 2:308/309 of 4zrnA
- active site: T117 (≠ S111), G119 (= G113), A120 (≠ T114), Y143 (≠ H136), K147 (= K140), Y181 (≠ R174), G185 (= G178)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (= F13), I12 (= I14), D31 (≠ E37), N32 (≠ T38), S34 (≠ A40), S35 (≠ H41), G36 (≠ L42), S51 (vs. gap), I52 (≠ V50), L73 (≠ T68), A74 (= A69), A75 (≠ S70), T92 (vs. gap), S115 (≠ I109), S116 (= S110), Y143 (≠ H136), K147 (= K140), Y170 (≠ P163), V173 (= V166)
- binding uridine-5'-diphosphate-glucose: T117 (≠ S111), G119 (= G113), A120 (≠ T114), Y143 (≠ H136), N172 (= N165), G185 (= G178), V186 (= V179), H201 (≠ E194), F203 (≠ W196), Y208 (≠ A201), R210 (= R203), V244 (≠ L240), R267 (= R263), D270 (= D266)
6wjaA Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac (see paper)
28% identity, 98% coverage: 3:300/305 of query aligns to 1:307/307 of 6wjaA
- active site: A118 (≠ S111), A119 (≠ G112), A120 (≠ G113), F143 (≠ H136), K147 (= K140)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (= F13), I12 (= I14), D31 (vs. gap), D32 (vs. gap), S34 (vs. gap), T35 (vs. gap), G36 (vs. gap), A55 (≠ L49), L74 (≠ T68), A75 (= A69), A76 (≠ S70), S93 (vs. gap), F143 (≠ H136), K147 (= K140), F170 (≠ P163), F171 (≠ S164), I173 (≠ V166)
- binding uridine-diphosphate-n-acetylgalactosamine: V80 (≠ P74), A120 (≠ G113), N172 (= N165), G186 (= G178), V187 (= V179), F191 (≠ G183), T202 (≠ E194), F204 (≠ W196), R211 (= R203), L247 (= L240), R270 (= R263), D273 (= D266)
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
28% identity, 98% coverage: 3:300/305 of query aligns to 2:308/308 of 6wj9B
- active site: A119 (≠ S111), A120 (≠ G112), A121 (≠ G113), F144 (≠ H136), K148 (= K140)
- binding nicotinamide-adenine-dinucleotide: G8 (= G9), G11 (= G12), F12 (= F13), I13 (= I14), D32 (vs. gap), D33 (vs. gap), S35 (vs. gap), T36 (vs. gap), G37 (vs. gap), D55 (≠ N48), A56 (≠ L49), L75 (≠ T68), A76 (= A69), A77 (≠ S70), S94 (vs. gap), A117 (≠ I109), A119 (≠ S111), F144 (≠ H136), K148 (= K140), F171 (≠ P163), F172 (≠ S164), I174 (≠ V166)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (≠ P74), N173 (= N165), G187 (= G178), V188 (= V179), F192 (≠ G183), T203 (≠ E194), L204 (≠ I195), F205 (≠ W196), R212 (= R203), L248 (= L240), R271 (= R263), D274 (= D266)
2b69A Crystal structure of human udp-glucoronic acid decarboxylase
27% identity, 99% coverage: 2:304/305 of query aligns to 1:308/312 of 2b69A
- active site: T115 (≠ G112), S116 (≠ G113), E117 (≠ T114), Y144 (≠ H136), K148 (= K140), R185 (≠ G178)
- binding nicotinamide-adenine-dinucleotide: G8 (= G9), G11 (= G12), F12 (= F13), V13 (≠ I14), D32 (vs. gap), N33 (vs. gap), T36 (= T33), G37 (≠ R34), D57 (= D53), V58 (≠ D54), L72 (≠ T68), A73 (= A69), S74 (= S70), A76 (≠ S72), T91 (vs. gap), T115 (≠ G112), Y144 (≠ H136), K148 (= K140), I171 (≠ P163), N173 (= N165), R185 (≠ G178)
- binding uridine-5'-diphosphate: P61 (≠ A57), L62 (≠ A58), Y63 (≠ L59), P78 (= P74), N98 (≠ T93), G101 (≠ A97), L102 (= L98), K104 (≠ Q100), R105 (≠ Q101), Y158 (≠ W150), N173 (= N165), R185 (≠ G178), V186 (= V179), N189 (= N182), T201 (≠ E194), Y203 (≠ W196), Q208 (≠ A201), R210 (= R203), I244 (≠ G237), D270 (= D266)
Q8NBZ7 UDP-glucuronic acid decarboxylase 1; UDP-glucuronate decarboxylase 1; UGD; UXS-1; hUXS; hUXS1; EC 4.1.1.35 from Homo sapiens (Human) (see 4 papers)
27% identity, 99% coverage: 2:304/305 of query aligns to 88:395/420 of Q8NBZ7
- G98 (= G12) binding
- F99 (= F13) binding
- V100 (≠ I14) binding
- D119 (vs. gap) binding
- N120 (vs. gap) binding
- F122 (vs. gap) binding
- T123 (= T33) binding
- G124 (≠ R34) binding
- D144 (= D53) binding
- V145 (≠ D54) binding
- L149 (≠ A58) binding
- Y150 (≠ L59) binding
- L159 (≠ T68) binding
- S161 (= S70) binding
- K177 (≠ Q86) binding
- T178 (vs. gap) binding
- N185 (≠ T93) binding
- G188 (≠ A97) binding
- K191 (≠ Q100) binding
- R192 (≠ Q101) binding
- A200 (≠ S110) binding
- E204 (≠ T114) mutation to A: Reduced UDP-glucuronic acid decarboxylase activity.
- Y231 (≠ H136) active site, Proton acceptor; binding ; mutation to F: Abolished UDP-glucuronic acid decarboxylase activity.
- K235 (= K140) binding
- R236 (≠ I141) mutation to H: Strongly reduced UDP-glucuronic acid decarboxylase activity, caused by a local unfolding of the active site that allows for a rotation of the dimer interface, leading to the formation of a homohexamer.
- Y245 (≠ W150) binding
- Q248 (= Q153) binding
- E249 (≠ Q154) binding
- T261 (≠ V166) binding
- H267 (≠ E172) binding
- R272 (≠ G178) binding
- R361 (≠ V270) mutation to Q: Strongly reduced UDP-glucuronic acid decarboxylase activity.
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
Q6GMI9 UDP-glucuronic acid decarboxylase 1; UDP-glucuronate decarboxylase 1; UXS-1; EC 4.1.1.35 from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
28% identity, 99% coverage: 2:304/305 of query aligns to 86:393/418 of Q6GMI9
- R234 (≠ I141) mutation to H: In Man o' war (mow) mutant; characterized by severe craniofacial defects. Fishes show defective organization and morphogenesis of chondrocytes, perichondrium and bone.
6dntA Udp-n-acetylglucosamine 4-epimerase from methanobrevibacter ruminantium m1 in complex with udp-n-acetylmuramic acid (see paper)
25% identity, 98% coverage: 1:300/305 of query aligns to 1:306/310 of 6dntA
- active site: S120 (≠ G112), S121 (≠ G113), A122 (≠ T114), Y144 (≠ H136), K148 (= K140), A187 (≠ G178)
- binding (2R)-2-{[(2R,3R,4R,5S,6R)-3-(acetylamino)-2-{[(S)-{[(R)-{[(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methoxy}(hydroxy)phosphoryl]oxy}(hydroxy)phosphoryl]oxy}-5-hydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-4-yl]oxy}propanoic acid: A80 (≠ S71), S120 (≠ G112), S121 (≠ G113), Y144 (≠ H136), F172 (≠ S164), N173 (= N165), A187 (≠ G178), V188 (= V179), K191 (≠ N182), V203 (≠ E194), I204 (= I195), Y205 (≠ W196), Q210 (≠ A201), R212 (= R203), I246 (≠ L240), R269 (= R263), D272 (= D266)
- binding nicotinamide-adenine-dinucleotide: G10 (= G9), G13 (= G12), F14 (= F13), I15 (= I14), D33 (vs. gap), N34 (vs. gap), L35 (vs. gap), S36 (≠ A32), S37 (≠ T33), G38 (≠ R34), D57 (= D53), L58 (vs. gap), L76 (≠ T68), A77 (= A69), A78 (≠ S70), A80 (≠ S71), S118 (= S110), S119 (= S111), Y144 (≠ H136), K148 (= K140), Y171 (≠ P163), V174 (= V166)
- binding zinc ion: E209 (≠ S200), H275 (= H269)
Q9SA77 UDP-arabinose 4-epimerase 1; UDP-D-xylose 4-epimerase 1; EC 5.1.3.5 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 97% coverage: 5:301/305 of query aligns to 73:403/419 of Q9SA77
- G275 (≠ N182) mutation to D: In mur4-1; 50% reduction in L-Ara in cell wall material.
- R304 (= R203) mutation to Q: In mur4-3; 50% reduction in L-Ara in cell wall material.
7ysmA Crystal structure of udp-glucose 4-epimerase (rv3634c) co-crystallized with udp-n-acetylglucosamine from mycobacterium tuberculosis
30% identity, 97% coverage: 6:301/305 of query aligns to 4:309/311 of 7ysmA
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (= F13), I12 (= I14), D31 (vs. gap), N32 (vs. gap), T35 (= T33), G36 (≠ R34), D56 (= D54), I57 (≠ F55), L77 (≠ T68), A78 (= A69), A79 (≠ S70), I81 (≠ S72), T119 (≠ I109), Y146 (≠ H136), K150 (= K140), P173 (= P163), N175 (= N165), V176 (= V166)
- binding uridine-diphosphate-n-acetylgalactosamine: I81 (≠ S72), R84 (≠ G75), S121 (= S111), G123 (= G113), S124 (≠ T114), Y146 (≠ H136), A174 (≠ S164), N175 (= N165), G188 (= G178), V189 (= V179), F193 (≠ G183), R204 (≠ E194), V205 (≠ I195), F206 (≠ W196), N211 (≠ A201), R213 (= R203), D248 (≠ L240), R271 (= R263)
7ystA Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chain b from mycobacterium tuberculosis
30% identity, 97% coverage: 6:301/305 of query aligns to 4:309/312 of 7ystA
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (= F13), I12 (= I14), D31 (vs. gap), N32 (vs. gap), T35 (= T33), G36 (≠ R34), D56 (= D54), I57 (≠ F55), L77 (≠ T68), A78 (= A69), A79 (≠ S70), I81 (≠ S72), V96 (≠ Q86), T119 (≠ I109), Y146 (≠ H136), K150 (= K140), P173 (= P163), A174 (≠ S164), N175 (= N165), V176 (= V166)
- binding uridine-5'-diphosphate-glucose: I81 (≠ S72), R84 (≠ G75), S121 (= S111), G123 (= G113), Y146 (≠ H136), A174 (≠ S164), N175 (= N165), A187 (≠ F177), G188 (= G178), V189 (= V179), F193 (≠ G183), R204 (≠ E194), V205 (≠ I195), F206 (≠ W196), R213 (= R203), D248 (≠ L240), R271 (= R263)
7ys9A Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chaina from mycobacterium tuberculosis
30% identity, 97% coverage: 6:301/305 of query aligns to 4:309/310 of 7ys9A
- binding galactose-uridine-5'-diphosphate: I81 (≠ S72), R84 (≠ G75), S121 (= S111), G123 (= G113), Y146 (≠ H136), A174 (≠ S164), N175 (= N165), A187 (≠ F177), G188 (= G178), V189 (= V179), F193 (≠ G183), R204 (≠ E194), F206 (≠ W196), N211 (≠ A201), R213 (= R203), D248 (≠ L240), R271 (= R263)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (= F13), I12 (= I14), D31 (vs. gap), N32 (vs. gap), A34 (= A32), T35 (= T33), G36 (≠ R34), D56 (= D54), I57 (≠ F55), L77 (≠ T68), A78 (= A69), A79 (≠ S70), I81 (≠ S72), T119 (≠ I109), Y146 (≠ H136), K150 (= K140), P173 (= P163), A174 (≠ S164), V176 (= V166)
- binding uridine-5'-diphosphate-glucose: I81 (≠ S72), R84 (≠ G75), S121 (= S111), G123 (= G113), Y146 (≠ H136), A174 (≠ S164), N175 (= N165), A187 (≠ F177), G188 (= G178), V189 (= V179), F193 (≠ G183), R204 (≠ E194), F206 (≠ W196), N211 (≠ A201), R213 (= R203), D248 (≠ L240), R271 (= R263)
8vr2B Crystal structure of the pcryo_0617 oxidoreductase/decarboxylase from psychrobacter cryohalolentis k5 in the presence of NAD and udp
27% identity, 98% coverage: 5:304/305 of query aligns to 10:315/321 of 8vr2B
- binding nicotinamide-adenine-dinucleotide: G14 (= G9), G17 (= G12), F18 (= F13), I19 (= I14), D37 (≠ A32), N38 (≠ T33), E40 (≠ R35), R41 (≠ P36), N61 (= N48), V62 (≠ L49), A81 (≠ T68), A82 (= A69), A83 (≠ S70), F124 (≠ I109), K154 (= K140), P177 (= P163), N179 (= N165)
- binding uridine-5'-diphosphate: R147 (= R129), G189 (= G178), A190 (≠ V179), M194 (≠ G183), Y205 (≠ E194), I206 (= I195), F207 (≠ W196), R214 (= R203), I251 (≠ L240)
4lk3B Crystal structure of human udp-xylose synthase r236a substitution (see paper)
26% identity, 99% coverage: 2:304/305 of query aligns to 1:270/274 of 4lk3B
- active site: T112 (≠ S111), S113 (= S128), E114 (≠ R129), K119 (= K140), R156 (≠ G178)
- binding nicotinamide-adenine-dinucleotide: G8 (= G9), G11 (= G12), F12 (= F13), V13 (≠ I14), D32 (vs. gap), N33 (vs. gap), T36 (= T33), G37 (≠ R34), D57 (= D53), V58 (≠ D54), L72 (≠ T68), A73 (= A69), S74 (= S70), P75 (= P74), T88 (vs. gap), A110 (≠ I109), T112 (≠ S111), K119 (= K140), I142 (≠ P163), H151 (≠ E172)
- binding uridine-5'-diphosphate: R156 (≠ G178), V157 (= V179), N160 (= N182), T172 (≠ E194), Y174 (≠ W196), Q179 (≠ A201), R181 (= R203), I215 (≠ G237)
- binding uridine-5'-diphosphate-glucuronic acid: P61 (≠ A57), L62 (≠ A58), Y63 (≠ L59), I83 (≠ L82), K87 (≠ Q86), N95 (≠ T93), G98 (≠ A97), L99 (= L98), K101 (≠ Q100), Y129 (≠ W150), E133 (≠ Q154)
6kvcA Moee5 in complex with udp-glucose and NAD (see paper)
29% identity, 98% coverage: 5:304/305 of query aligns to 3:298/299 of 6kvcA
- active site: S109 (≠ G112), S110 (≠ G113), S111 (≠ T114), Y132 (≠ H136), K136 (= K140)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (= F13), I12 (= I14), D31 (≠ T33), R32 (= R34), R33 (= R35), D46 (≠ S43), L47 (≠ A44), L65 (≠ T68), A66 (= A69), A67 (≠ S72), P69 (= P74), A107 (≠ S110), S109 (≠ G112), K136 (= K140), F161 (≠ P163), T163 (≠ N165), V164 (= V166), R170 (≠ E172), M173 (≠ V175)
- binding uridine-5'-diphosphate-glucose: P69 (= P74), R72 (vs. gap), S109 (≠ G112), S110 (≠ G113), Y132 (≠ H136), T163 (≠ N165), M173 (≠ V175), F174 (≠ V179), R177 (≠ N182), E189 (= E194), I190 (= I195), Y191 (≠ W196), Q196 (≠ A201), R198 (= R203), D260 (= D266)
6kv9A Moee5 in complex with udp-glucuronic acid and NAD (see paper)
29% identity, 98% coverage: 5:304/305 of query aligns to 3:299/299 of 6kv9A
- active site: S110 (≠ G112), S111 (≠ G113), S112 (≠ T114), Y133 (≠ H136), K137 (= K140)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (= F13), I12 (= I14), D31 (≠ T33), R32 (= R34), R33 (= R35), D47 (≠ E45), L48 (vs. gap), L66 (≠ T68), A67 (= A69), A68 (≠ S72), P70 (= P74), C85 (≠ Q86), A108 (≠ S110), S109 (= S111), K137 (= K140), F162 (≠ P163), T164 (≠ N165), V165 (= V166), R171 (≠ E172), M174 (≠ V175)
- binding uridine-5'-diphosphate-glucuronic acid: P70 (= P74), R73 (vs. gap), S110 (≠ G112), S111 (≠ G113), Y133 (≠ H136), T164 (≠ N165), R171 (≠ E172), M174 (≠ V175), F175 (≠ V179), R178 (≠ N182), E190 (= E194), I191 (= I195), Y192 (≠ W196), Q197 (≠ A201), R199 (= R203), V235 (≠ L240), D261 (= D266)
2c20A Crystal structure of udp-glucose 4-epimerase
27% identity, 97% coverage: 3:299/305 of query aligns to 1:319/329 of 2c20A
- active site: T117 (≠ S111), A118 (≠ G112), A119 (≠ G113), Y141 (≠ H136), K145 (= K140), H184 (≠ L173)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), Y11 (≠ F13), I12 (= I14), D31 (≠ T33), N32 (≠ R34), Q34 (≠ P36), T35 (≠ E37), G36 (≠ T38), D51 (= D53), L52 (≠ D54), F73 (≠ T68), A74 (= A69), A75 (≠ S70), N92 (≠ Q86), Y141 (≠ H136), K145 (= K140), Y168 (≠ P163), F169 (≠ S164), V171 (= V166), H184 (≠ L173)
- binding zinc ion: E182 (≠ Q171), H184 (≠ L173), E187 (≠ G176), H189 (≠ G178)
Q14376 UDP-glucose 4-epimerase; Galactowaldenase; UDP-N-acetylgalactosamine 4-epimerase; UDP-GalNAc 4-epimerase; UDP-N-acetylglucosamine 4-epimerase; UDP-GlcNAc 4-epimerase; UDP-galactose 4-epimerase; EC 5.1.3.2; EC 5.1.3.7 from Homo sapiens (Human) (see 13 papers)
27% identity, 99% coverage: 1:301/305 of query aligns to 1:338/348 of Q14376
- GYI 12:14 (≠ GFI 12:14) binding
- DNFHN 33:37 (vs. gap) binding
- N34 (vs. gap) to S: in GALAC3; peripheral; nearly normal activity towards UDP-galactose; dbSNP:rs121908046
- DI 66:67 (≠ VT 50:51) binding
- F88 (≠ T68) binding
- G90 (≠ S70) to E: in GALAC3; 800-fold decrease in UDP-galactose epimerization activity; dbSNP:rs28940882
- K92 (≠ S72) binding
- V94 (≠ P74) to M: in GALAC3; generalized; 30-fold decrease in UDP-galactose epimerization activity; 2-fold decrease in affinity for UDP-galactose; 24% of normal activity with respect to UDP-N-acetylgalactosamine; dbSNP:rs121908047
- D103 (≠ K83) to G: in GALAC3; 7-fold decrease in UDP-galactose epimerization activity; very mild decrease in activity towards UDP-N-acetylgalactosamine; dbSNP:rs28940883
- S132 (≠ G112) mutation to A: Loss of activity.
- SAT 132:134 (≠ GGT 112:114) binding
- Y157 (≠ H136) active site, Proton acceptor; mutation to F: Loss of activity.
- K161 (= K140) binding
- A180 (= A158) to V: in dbSNP:rs3204468
- L183 (≠ I161) to P: in GALAC3; peripheral; 3-fold decrease in UDP-galactose epimerization activity; dbSNP:rs121908045
- Y185 (≠ P163) binding
- YFN 185:187 (≠ PSN 163:165) binding
- NNL 206:208 (≠ NGF 182:184) binding
- NVF 224:226 (≠ EIW 194:196) binding
- R239 (= R203) binding
- K257 (≠ I218) to R: in GALAC3; 7-fold decrease in UDP-galactose epimerization activity; does not affect affinity for UDP-galactose; dbSNP:rs28940884
- REGD 300:303 (≠ RSLD 263:266) binding
- C307 (≠ V270) mutation to Y: No effect on activity towards UDP-galactose. Loss of activity towards UDP-N-acetylgalactosamine.
- L313 (≠ H276) to M: in GALAC3; 6-fold decrease in UDP-galactose epimerization activity; very mild decrease in activity towards UDP-N-acetylgalactosamine; dbSNP:rs3180383
- G319 (= G282) to E: in GALAC3; nearly normal activity towards UDP-galactose; mild impairment under conditions of substrate limitation; dbSNP:rs28940885
- R335 (≠ N298) to H: in GALAC3; 2-fold decrease in UDP-galactose epimerization activity; dbSNP:rs368637540
3vpsA Structure of a novel NAD dependent-ndp-hexosamine 5,6-dehydratase, tuna, involved in tunicamycin biosynthesis
29% identity, 98% coverage: 5:303/305 of query aligns to 4:299/303 of 3vpsA
- active site: T113 (≠ G112), C114 (≠ G113), E115 (≠ T114), Y137 (≠ H136), K141 (= K140), D176 (≠ R174)
- binding nicotinamide-adenine-dinucleotide: G8 (= G9), G11 (= G12), F12 (= F13), I13 (= I14), D32 (≠ T33), D33 (vs. gap), R35 (= R34), V36 (≠ R35), P52 (≠ E45), V53 (≠ A46), L70 (≠ T68), A71 (= A69), S72 (= S70), K74 (≠ S72), T113 (≠ G112), K141 (= K140), F165 (≠ P163), V168 (= V166)
- binding uridine-diphosphate-n-acetylglucosamine: K74 (≠ S72), T113 (≠ G112), C114 (≠ G113), E115 (≠ T114), Y137 (≠ H136), N167 (= N165), D176 (≠ R174), A177 (≠ G178), L178 (≠ V179), R181 (≠ N182), P193 (≠ E194), V194 (≠ I195), E195 (≠ W196), Q200 (≠ A201), R202 (= R203), V236 (≠ L240), R258 (≠ P262), E261 (≠ L265)
1ek6A Structure of human udp-galactose 4-epimerase complexed with nadh and udp-glucose (see paper)
27% identity, 99% coverage: 1:301/305 of query aligns to 1:338/346 of 1ek6A
- active site: S132 (≠ G112), A133 (≠ G113), T134 (= T114), Y157 (≠ H136), K161 (= K140)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G9), G12 (= G12), Y13 (≠ F13), I14 (= I14), D33 (vs. gap), N34 (vs. gap), H36 (vs. gap), N37 (vs. gap), D66 (≠ V50), I67 (≠ T51), F88 (≠ T68), A89 (= A69), G90 (≠ S70), K92 (≠ S72), S130 (= S110), S131 (= S111), S132 (≠ G112), Y157 (≠ H136), K161 (= K140), Y185 (≠ P163), P188 (≠ V166)
- binding uridine-5'-diphosphate-glucose: S132 (≠ G112), Y157 (≠ H136), F186 (≠ S164), N187 (= N165), N207 (≠ G183), L208 (≠ F184), N224 (≠ E194), V225 (≠ I195), F226 (≠ W196), R239 (= R203), Y241 (= Y205), V277 (≠ L240), R300 (= R263), D303 (= D266)
6bwlA X-ray structure of pal from bacillus thuringiensis (see paper)
27% identity, 97% coverage: 5:301/305 of query aligns to 3:310/313 of 6bwlA
- active site: T122 (≠ S111), C123 (≠ G112), M124 (≠ G113), Y147 (≠ H136), K151 (= K140)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (= F13), I12 (= I14), D31 (≠ T33), N32 (≠ R34), L33 (≠ R35), N35 (≠ E37), S36 (vs. gap), D57 (vs. gap), I58 (≠ V50), L79 (≠ T68), A80 (= A69), A81 (≠ S70), I83 (≠ S72), M120 (≠ I109), K151 (= K140), N176 (= N165), T177 (≠ V166)
- binding uridine-5'-diphosphate: N176 (= N165), G189 (= G178), V190 (= V179), N205 (≠ E194), I206 (= I195), Y207 (≠ W196), Q212 (≠ A201), R214 (= R203), I250 (≠ L240), E275 (≠ D266)
Query Sequence
>N515DRAFT_1702 N515DRAFT_1702 UDP-glucose 4-epimerase
MRDSILILGAAGFIGRHLTQALLDSGHRVMVATRRPETLAHLSAEALNLVTPDDFRAALA
KAHTVIHTASSSTPGSSSGQPLKELQNLTPTLTLLEALHQQPSIRLIYISSGGTLYTNHD
RTPATEKSRIWPRSYHGAGKIAAESFIEAWCSQQAGSATVIRPSNVYGPGQELRVGFGVI
PNGFAKLKRGEAMEIWGDGSATRDYLYIDDFVELCLRILSEPAKSGFEIFNASSGTGTSL
NQLLQQMELVAGTALKRVYHPPRSLDAEHVVIDAMHAAQRLGWAATTPLQKGLEQTWNWL
KPRLP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory