Comparing N515DRAFT_1733 FitnessBrowser__Dyella79:N515DRAFT_1733 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P37595 Isoaspartyl peptidase; Beta-aspartyl-peptidase; EcAIII; Isoaspartyl dipeptidase; EC 3.4.19.5 from Escherichia coli (strain K12) (see 2 papers)
51% identity, 94% coverage: 8:315/329 of query aligns to 5:316/321 of P37595
Q7L266 Isoaspartyl peptidase/L-asparaginase; Asparaginase-like protein 1; Beta-aspartyl-peptidase; Isoaspartyl dipeptidase; L-asparagine amidohydrolase; EC 3.4.19.5; EC 3.5.1.1 from Homo sapiens (Human) (see 4 papers)
39% identity, 96% coverage: 7:322/329 of query aligns to 3:308/308 of Q7L266
4osxA Structure of uncleaved glycine-bound human l-asparaginase protein (see paper)
39% identity, 96% coverage: 7:322/329 of query aligns to 4:300/300 of 4osxA
4pvrA Crystal structure of partially-cleaved human l-asparaginase protein in complex with l-aspartate (see paper)
39% identity, 96% coverage: 7:322/329 of query aligns to 4:298/298 of 4pvrA
4o0hA Crystal structure of human l-asparaginase protein with covalently linked substrate l-asparagine (see paper)
39% identity, 96% coverage: 7:322/329 of query aligns to 4:295/295 of 4o0hA
4o48A Crystal structure of cleaved guinea pig l-asparaginase type iii in complex with l-aspartate (see paper)
39% identity, 93% coverage: 7:313/329 of query aligns to 4:291/298 of 4o48A
1jn9A Structure of putative asparaginase encoded by escherichia coli ybik gene (see paper)
52% identity, 47% coverage: 8:161/329 of query aligns to 4:158/158 of 1jn9A
8c0iAAA Isoaspartyl peptidase subunit alpha (see paper)
52% identity, 46% coverage: 8:158/329 of query aligns to 4:155/156 of 8c0iAAA
1p4vA Crystal structure of the glycosylasparaginase precursor d151n mutant with glycine (see paper)
35% identity, 80% coverage: 42:303/329 of query aligns to 22:274/295 of 1p4vA
Q47898 N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase; Aspartylglucosaminidase; AGA; Glycosylasparaginase; N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase; EC 3.5.1.26 from Elizabethkingia miricola (Chryseobacterium miricola) (see 5 papers)
35% identity, 80% coverage: 42:303/329 of query aligns to 67:319/340 of Q47898
Sites not aligning to the query:
2zalB Crystal structure of e. Coli isoaspartyl aminopeptidase/l-asparaginase in complex with l-aspartate (see paper)
55% identity, 40% coverage: 179:310/329 of query aligns to 1:133/135 of 2zalB
4r4yA Structural basis of a point mutation that causes the genetic disease aspartylglucosaminuria (see paper)
35% identity, 80% coverage: 42:303/329 of query aligns to 20:272/293 of 4r4yA
8c23DDD Isoaspartyl peptidase subunit beta (see paper)
54% identity, 40% coverage: 179:310/329 of query aligns to 1:133/135 of 8c23DDD
2gezC Crystal structure of potassium-independent plant asparaginase (see paper)
44% identity, 46% coverage: 9:160/329 of query aligns to 5:156/166 of 2gezC
2gezB Crystal structure of potassium-independent plant asparaginase (see paper)
53% identity, 40% coverage: 179:310/329 of query aligns to 1:130/133 of 2gezB
4pv2C Crystal structure of potassium-dependent plant-type l-asparaginase from phaseolus vulgaris in complex with k+ and na+ cations (see paper)
41% identity, 46% coverage: 9:158/329 of query aligns to 5:153/158 of 4pv2C
Q9H6P5 Threonine aspartase 1; Taspase-1; EC 3.4.25.- from Homo sapiens (Human) (see 2 papers)
33% identity, 72% coverage: 9:244/329 of query aligns to 44:306/420 of Q9H6P5
4pu6B Crystal structure of potassium-dependent plant-type l-asparaginase from phaseolus vulgaris in complex with k+ cations (see paper)
49% identity, 40% coverage: 179:310/329 of query aligns to 1:130/131 of 4pu6B
2a8jB Crystal structure of human taspase1 (acivated form) (see paper)
32% identity, 72% coverage: 9:244/329 of query aligns to 4:213/313 of 2a8jB
P20933 N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase; Aspartylglucosaminidase; Glycosylasparaginase; N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase; EC 3.5.1.26 from Homo sapiens (Human) (see 11 papers)
31% identity, 57% coverage: 34:219/329 of query aligns to 36:246/346 of P20933
Sites not aligning to the query:
>N515DRAFT_1733 FitnessBrowser__Dyella79:N515DRAFT_1733
MSHATTPVLVIHGGAGVIKHDMNPAREKAVRAALTQALQNGYAQLKAGKPAMDAVTAAIT
VLENDPNFNAGKGAVFTHDGKNELDAAVMDGYTLKAGAIAGVHRVKNPILLARAVMEKSQ
HVMLAGDGAEAFAKEAGIELVDPAYFRTEERWQQLQKALKEDAEHRQHEDVETAKHFGTV
GAVALDAQGRLAAGTSTGGMTNKRWGRIGDSPLIGAGTYANNGCAVSGTGWGEFYIRTVA
AHEICMRVTQMRVPLKRAAAEVINQEIPSMGGNGGAIALDAQGNVAMPFNTDGMFRGWIA
EDGKPHVAIYGDDDDGTGDPLPASDSSAE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory