Comparing N515DRAFT_1749 FitnessBrowser__Dyella79:N515DRAFT_1749 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q6NPM8 Bifunctional phosphatase IMPL2, chloroplastic; Histidinol-phosphatase; Histidinol-phosphate phosphatase; HPP; Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Protein HISTIDINE BIOSYNTHESIS 7; Protein MYO-INOSITOL MONOPHOSPHATASE-LIKE 2; EC 3.1.3.15; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 97% coverage: 1:253/262 of query aligns to 78:340/346 of Q6NPM8
5eq8A Crystal structure of medicago truncatula histidinol-phosphate phosphatase (mthpp) in complex with l-histidinol (see paper)
36% identity, 92% coverage: 13:253/262 of query aligns to 9:254/259 of 5eq8A
5eq9B Crystal structure of medicago truncatula histidinol-phosphate phosphatase (mthpp) in complex with l-histidinol phosphate and mg2+ (see paper)
35% identity, 95% coverage: 6:253/262 of query aligns to 3:255/260 of 5eq9B
Q9K4B1 Histidinol-phosphatase; HolPase; Histidinol-phosphate phosphatase; EC 3.1.3.15 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see paper)
40% identity, 77% coverage: 32:233/262 of query aligns to 31:240/266 of Q9K4B1
5t3jA Histidinol phosphate phosphatase(hpp) soaked with selenourea for 10 min (see paper)
35% identity, 95% coverage: 6:253/262 of query aligns to 5:252/257 of 5t3jA
Sites not aligning to the query:
P95189 Histidinol-phosphatase; HolPase; Histidinol-phosphate phosphatase; EC 3.1.3.15 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
36% identity, 98% coverage: 1:258/262 of query aligns to 1:259/260 of P95189
5zonA Histidinol phosphate phosphatase from mycobacterium tuberculosis (see paper)
36% identity, 86% coverage: 32:256/262 of query aligns to 27:255/256 of 5zonA
5yhtA Crystal structure of a phosphatase from mycobacterium tuberculosis in complex with its substrate (see paper)
36% identity, 86% coverage: 32:256/262 of query aligns to 26:254/255 of 5yhtA
2p3nA Thermotoga maritima impase tm1415 (see paper)
34% identity, 85% coverage: 27:249/262 of query aligns to 21:239/256 of 2p3nA
O33832 Fructose-1,6-bisphosphatase/inositol-1-monophosphatase; FBPase/IMPase; Inositol-1-phosphatase; I-1-Pase; EC 3.1.3.11; EC 3.1.3.25 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
34% identity, 85% coverage: 27:249/262 of query aligns to 21:239/256 of O33832
2hhmA Structure of inositol monophosphatase, the putative target of lithium therapy (see paper)
27% identity, 95% coverage: 6:255/262 of query aligns to 5:260/272 of 2hhmA
1imbA Structural analysis of inositol monophosphatase complexes with substrates (see paper)
27% identity, 95% coverage: 6:255/262 of query aligns to 5:260/272 of 1imbA
1awbA Human myo-inositol monophosphatase in complex with d-inositol-1- phosphate and calcium
27% identity, 95% coverage: 6:255/262 of query aligns to 5:260/272 of 1awbA
6giuA Human impase with l-690330 (see paper)
27% identity, 95% coverage: 6:255/262 of query aligns to 7:262/275 of 6giuA
1imdA Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis (see paper)
27% identity, 95% coverage: 6:255/262 of query aligns to 5:260/266 of 1imdA
6zk0AAA human impase with ebselen (see paper)
27% identity, 95% coverage: 6:255/262 of query aligns to 6:261/274 of 6zk0AAA
4as4A Structure of human inositol monophosphatase 1 (see paper)
27% identity, 95% coverage: 6:255/262 of query aligns to 7:262/274 of 4as4A
P29218 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Homo sapiens (Human) (see 5 papers)
27% identity, 95% coverage: 6:255/262 of query aligns to 9:264/277 of P29218
3lv0A Crystal structure of extragenic suppressor protein suhb from bartonella henselae, native
33% identity, 88% coverage: 16:245/262 of query aligns to 11:243/258 of 3lv0A
2qflA Structure of suhb: inositol monophosphatase and extragenic suppressor from e. Coli (see paper)
29% identity, 98% coverage: 4:260/262 of query aligns to 3:261/262 of 2qflA
>N515DRAFT_1749 FitnessBrowser__Dyella79:N515DRAFT_1749
MSAPDLQRALSAAREAAEAAAEVIRHYWRRGVEVEIKSDATPVTIADREAELAIRKVLQA
ALPEAAIYGEEFGLDDGARELLWLVDPLDGTKSFVRRTPFFSTQIALMHKGELVLGVSSA
PVYGETLWASAGGGAWFEGDRVRVAATDSMAQASISTGNVKTLTMDARWAELGAMIRDSN
RIRGYGDFCHYHLLARGGLDLVIESDVNILDVAALAAIVREAGGLFTDLDGQPLTLDTRS
VLAGTPALHAQALTRFRASLQS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory