SitesBLAST
Comparing N515DRAFT_1751 FitnessBrowser__Dyella79:N515DRAFT_1751 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3du4A Crystal structure of 7-keto-8-aminopelargonic acid bound 7,8- diaminopelargonic acid synthase in bacillus subtilis (see paper)
43% identity, 94% coverage: 23:461/467 of query aligns to 5:440/448 of 3du4A
- active site: F17 (≠ C35), Y146 (= Y166), E217 (= E238), D251 (= D272), A254 (= A275), K280 (= K301), A417 (≠ Y438)
- binding 7-keto-8-aminopelargonic acid: L82 (≠ A102), Y146 (= Y166), G315 (≠ S336), S317 (= S338), R410 (= R431)
- binding pyridoxal-5'-phosphate: S112 (≠ N132), G113 (= G133), A114 (≠ S134), Y146 (= Y166), H147 (= H167), E217 (= E238), D251 (= D272), V253 (≠ I274), A254 (= A275), K280 (= K301), H316 (= H337), S317 (= S338)
P53555 L-Lysine--8-amino-7-oxononanoate transaminase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; Diaminopelargonic acid synthase; L-Lysine--8-amino-7-oxononanoate aminotransferase; EC 2.6.1.105 from Bacillus subtilis (strain 168) (see paper)
43% identity, 94% coverage: 23:461/467 of query aligns to 5:440/448 of P53555
- GA 113:114 (≠ GS 133:134) binding
- Y146 (= Y166) binding
- K280 (= K301) modified: N6-(pyridoxal phosphate)lysine
- G315 (≠ S336) binding
- HS 316:317 (= HS 337:338) binding
- R410 (= R431) binding
6zhkA Crystal structure of adenosylmethionine-8-amino-7-oxononanoate aminotransferase from methanocaldococcus jannaschii dsm 2661
40% identity, 95% coverage: 23:464/467 of query aligns to 5:436/438 of 6zhkA
6wnnA Bacillus subtilis bioa in complex with amino donor l-lys
41% identity, 94% coverage: 23:461/467 of query aligns to 2:412/420 of 6wnnA
- active site: F14 (≠ C35), Y143 (= Y166), D223 (= D272), K252 (= K301)
- binding (2S)-2-amino-6-[[3-hydroxy-2-methyl-5-(phosphonooxymethyl)pyridin-4-yl]methylideneamino]hexanoic acid: F14 (≠ C35), W51 (= W74), S109 (≠ N132), G110 (= G133), A111 (≠ S134), Y143 (= Y166), H144 (= H167), D223 (= D272), V225 (≠ I274), K252 (= K301), R382 (= R431)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: H288 (= H337), S289 (= S338)
3dodA Crystal structure of plp bound 7,8-diaminopelargonic acid synthase in bacillus subtilis (see paper)
41% identity, 94% coverage: 23:461/467 of query aligns to 3:409/417 of 3dodA
- active site: F15 (≠ C35), E186 (= E238), D220 (= D272), A223 (= A275), K249 (= K301), A386 (≠ Y438)
- binding pyridoxal-5'-phosphate: W52 (= W74), S110 (≠ N132), G111 (= G133), A112 (≠ S134), D220 (= D272), V222 (≠ I274), K249 (= K301), H285 (= H337), S286 (= S338)
6ed7A Crystal structure of 7,8-diaminopelargonic acid synthase bound to inhibitor mac13772
43% identity, 95% coverage: 25:467/467 of query aligns to 7:423/429 of 6ed7A
- active site: Y17 (≠ C35), Y144 (= Y166), D245 (= D272), K274 (= K301)
- binding 2-[(2-nitrophenyl)sulfanyl]acetohydrazide: Y17 (≠ C35), W52 (= W73), W52 (= W73), Y144 (= Y166), D147 (≠ E169), A217 (= A244), K274 (= K301), R391 (= R431), F393 (≠ L433), F393 (≠ L433)
- binding pyridoxal-5'-phosphate: G112 (= G133), S113 (= S134), Y144 (= Y166), H145 (= H167), D245 (= D272), I247 (= I274), K274 (= K301)
P12995 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; Diaminopelargonic acid synthase; EC 2.6.1.62 from Escherichia coli (strain K12) (see 4 papers)
43% identity, 95% coverage: 25:467/467 of query aligns to 7:423/429 of P12995
- Y17 (≠ C35) mutation to F: Severely reduces the aminotransferase activity.
- W52 (= W73) binding
- GS 112:113 (= GS 133:134) binding
- Y144 (= Y166) mutation to F: Severely reduces the aminotransferase activity.
- D147 (≠ E169) mutation to N: Loss of aminotransferase activity.
- D245 (= D272) binding
- R253 (= R280) mutation to A: Has only a small effect on the rate of reaction with DAPA.; mutation to K: Increases aminotransferase activity toward SAM.; mutation to M: Loss of aminotransferase activity.; mutation to Q: Increases aminotransferase activity toward SAM.
- K274 (= K301) binding ; modified: N6-(pyridoxal phosphate)lysine
- G307 (≠ S336) binding
- PT 308:309 (≠ HS 337:338) binding
- R391 (= R431) binding ; mutation to A: Reduces aminotransferase activity.
1qj3A Crystal structure of 7,8-diaminopelargonic acid synthase in complex with 7-keto-8-aminopelargonic acid (see paper)
42% identity, 95% coverage: 25:467/467 of query aligns to 7:411/416 of 1qj3A
- active site: Y17 (≠ C35), Y144 (= Y166), E201 (= E238), D235 (= D272), A238 (= A275), K264 (= K301), Y386 (= Y438)
- binding 7-keto-8-aminopelargonic acid: Y17 (≠ C35), W52 (= W73), Y144 (= Y166), K264 (= K301), R379 (= R431), F381 (≠ L433)
- binding pyridoxal-5'-phosphate: G112 (= G133), S113 (= S134), Y144 (= Y166), H145 (= H167), G146 (= G168), D235 (= D272), I237 (= I274), A238 (= A275), K264 (= K301)
1mlzA Crystal structure of 7,8-diaminopelargonic acid synthase in complex with the trans-isomer of amiclenomycin. (see paper)
43% identity, 95% coverage: 25:467/467 of query aligns to 7:422/427 of 1mlzA
- active site: Y17 (≠ C35), Y144 (= Y166), E210 (= E238), D244 (= D272), A247 (= A275), K273 (= K301), Y397 (= Y438)
- binding pyridoxal-5'-phosphate: G112 (= G133), S113 (= S134), Y144 (= Y166), H145 (= H167), D244 (= D272), I246 (= I274), K273 (= K301), P307 (≠ H337), T308 (≠ S338)
- binding trans-amiclenomycin: W52 (= W73), W53 (= W74), Y144 (= Y166), K273 (= K301), R390 (= R431), F392 (≠ L433)
1mlyA Crystal structure of 7,8-diaminopelargonic acid synthase in complex with the cis isomer of amiclenomycin (see paper)
43% identity, 95% coverage: 25:467/467 of query aligns to 7:422/427 of 1mlyA
- active site: Y17 (≠ C35), Y144 (= Y166), E210 (= E238), D244 (= D272), A247 (= A275), K273 (= K301), Y397 (= Y438)
- binding cis-amiclenomycin: W52 (= W73), W53 (= W74), K273 (= K301), R390 (= R431), F392 (≠ L433)
- binding pyridoxal-5'-phosphate: G112 (= G133), S113 (= S134), Y144 (= Y166), H145 (= H167), D244 (= D272), I246 (= I274), K273 (= K301), P307 (≠ H337), T308 (≠ S338)
1dtyA Crystal structure of adenosylmethionine-8-amino-7-oxonanoate aminotransferase with pyridoxal phosphate cofactor.
43% identity, 95% coverage: 25:467/467 of query aligns to 7:423/429 of 1dtyA
- active site: Y17 (≠ C35), Y144 (= Y166), E211 (= E238), D245 (= D272), A248 (= A275), K274 (= K301), Y398 (= Y438)
- binding pyridoxal-5'-phosphate: G112 (= G133), S113 (= S134), Y144 (= Y166), H145 (= H167), D245 (= D272), I247 (= I274), K274 (= K301)
6erkA Crystal structure of diaminopelargonic acid aminotransferase from psychrobacter cryohalolentis (see paper)
39% identity, 91% coverage: 27:453/467 of query aligns to 10:405/420 of 6erkA
4w1vA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a thiazole inhibitor (see paper)
40% identity, 94% coverage: 21:458/467 of query aligns to 4:417/425 of 4w1vA
- active site: Y18 (≠ C35), Y147 (= Y166), E210 (= E238), D244 (= D272), A247 (= A275), K273 (= K301), Y397 (= Y438)
- binding dimethyl (2R)-5-(3-fluorophenyl)-1H-pyrrolo[1,2-c][1,3]thiazole-6,7-dicarboxylate 2-oxide: P17 (= P34), Y18 (≠ C35), W54 (= W73), M81 (≠ I100), G83 (≠ A102), Y147 (= Y166), G306 (≠ S336), P307 (≠ H337), T308 (≠ S338), F392 (≠ L433)
- binding pyridoxal-5'-phosphate: G114 (= G133), S115 (= S134), Y147 (= Y166), H148 (= H167), E210 (= E238), D244 (= D272), I246 (= I274), K273 (= K301)
4cxrA Mycobaterium tuberculosis transaminase bioa complexed with 1-(1,3- benzothiazol-2-yl)methanamine (see paper)
40% identity, 94% coverage: 21:458/467 of query aligns to 4:417/425 of 4cxrA
- active site: Y18 (≠ C35), Y147 (= Y166), E210 (= E238), D244 (= D272), A247 (= A275), K273 (= K301), Y397 (= Y438)
- binding 1-(1,3-benzothiazol-2-yl)methanamine: Y18 (≠ C35), W54 (= W73), W55 (= W74), A216 (= A244)
- binding pyridoxal-5'-phosphate: G114 (= G133), S115 (= S134), Y147 (= Y166), H148 (= H167), E210 (= E238), D244 (= D272), I246 (= I274), K273 (= K301), P307 (≠ H337), T308 (≠ S338)
4cxqA Mycobaterium tuberculosis transaminase bioa complexed with substrate kapa (see paper)
40% identity, 94% coverage: 21:458/467 of query aligns to 4:419/427 of 4cxqA
- active site: Y18 (≠ C35), Y149 (= Y166), E212 (= E238), D246 (= D272), A249 (= A275), K275 (= K301), Y399 (= Y438)
- binding 7-keto-8-aminopelargonic acid: W56 (= W73), Y149 (= Y166), G308 (≠ S336), T310 (≠ S338), R392 (= R431)
- binding pyridoxal-5'-phosphate: G116 (= G133), S117 (= S134), Y149 (= Y166), H150 (= H167), G151 (= G168), E212 (= E238), D246 (= D272), I248 (= I274), K275 (= K301), P309 (≠ H337), T310 (≠ S338)
3tfuA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, post-reaction complex with a 3,6- dihydropyrid-2-one heterocycle inhibitor (see paper)
39% identity, 94% coverage: 21:458/467 of query aligns to 5:411/417 of 3tfuA
- active site: Y19 (≠ C35), Y151 (= Y166), E204 (= E238), D238 (= D272), A241 (= A275), K267 (= K301), Y391 (= Y438)
- binding [5-hydroxy-4-({[6-(3-hydroxypropyl)-2-oxo-1,2-dihydropyridin-3-yl]amino}methyl)-6-methylpyridin-3-yl]methyl dihydrogen phosphate: W58 (= W73), G118 (= G133), S119 (= S134), Y151 (= Y166), H152 (= H167), D238 (= D272), I240 (= I274), K267 (= K301), P301 (≠ H337), T302 (≠ S338)
5te2A Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a mechanism-based inhibitor (see paper)
39% identity, 94% coverage: 21:458/467 of query aligns to 4:420/428 of 5te2A
- active site: Y18 (≠ C35), Y150 (= Y166), E213 (= E238), D247 (= D272), A250 (= A275), K276 (= K301), Y400 (= Y438)
- binding [5-hydroxy-4-({[6-(3-hydroxypropyl)-4-oxo-1,4-dihydropyridin-3-yl]amino}methyl)-6-methylpyridin-3-yl]methyl dihydrogen phosphate: Y18 (≠ C35), W57 (= W73), G117 (= G133), S118 (= S134), Y150 (= Y166), H151 (= H167), G152 (= G168), D247 (= D272), I249 (= I274), K276 (= K301), G309 (≠ S336), P310 (≠ H337), T311 (≠ S338)
4xjoA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead (see paper)
39% identity, 94% coverage: 21:458/467 of query aligns to 4:420/428 of 4xjoA
- active site: Y18 (≠ C35), Y150 (= Y166), E213 (= E238), D247 (= D272), A250 (= A275), K276 (= K301), Y400 (= Y438)
- binding 5-[4-(3-chlorobenzoyl)piperazin-1-yl]-1H-inden-1-one: P17 (= P34), Y18 (≠ C35), W57 (= W73), M84 (≠ I100), G86 (≠ A102), Y150 (= Y166), G165 (≠ A180), G166 (≠ L181), A219 (= A244), P310 (≠ H337), T311 (≠ S338)
- binding pyridoxal-5'-phosphate: G117 (= G133), S118 (= S134), Y150 (= Y166), H151 (= H167), G152 (= G168), E213 (= E238), D247 (= D272), I249 (= I274), K276 (= K301), P310 (≠ H337), T311 (≠ S338)
4xewA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a hts lead compound (see paper)
39% identity, 94% coverage: 21:458/467 of query aligns to 4:420/428 of 4xewA
- active site: Y18 (≠ C35), Y150 (= Y166), E213 (= E238), D247 (= D272), A250 (= A275), K276 (= K301), Y400 (= Y438)
- binding 6-(2-fluorophenyl)[1,3]dioxolo[4,5-g]quinolin-8(5H)-one: P17 (= P34), Y18 (≠ C35), W57 (= W73), Y150 (= Y166), P310 (≠ H337), T311 (≠ S338), R393 (= R431), F395 (≠ L433)
- binding pyridoxal-5'-phosphate: G117 (= G133), S118 (= S134), Y150 (= Y166), H151 (= H167), G152 (= G168), E213 (= E238), D247 (= D272), I249 (= I274), K276 (= K301), P310 (≠ H337), T311 (≠ S338)
4wyfA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a dsf fragment hit (see paper)
39% identity, 94% coverage: 21:458/467 of query aligns to 4:420/428 of 4wyfA
- active site: Y18 (≠ C35), Y150 (= Y166), E213 (= E238), D247 (= D272), A250 (= A275), K276 (= K301), Y400 (= Y438)
- binding N-(1-oxo-1H-inden-5-yl)acetamide: M84 (≠ I100), G86 (≠ A102), G309 (≠ S336), P310 (≠ H337), T311 (≠ S338)
- binding pyridoxal-5'-phosphate: G117 (= G133), S118 (= S134), Y150 (= Y166), H151 (= H167), G152 (= G168), E213 (= E238), D247 (= D272), I249 (= I274), K276 (= K301), P310 (≠ H337), T311 (≠ S338)
Query Sequence
>N515DRAFT_1751 FitnessBrowser__Dyella79:N515DRAFT_1751
MRQPAPNPDHTRMSPNESRNQALAARDLRHLWHPCTQMHDHAGTVPMLPIVRGEGPWLVD
ADGRRYLDGISSWWTNLFGHANPRIGAALKQQLDTLEHVIFAGFTHEPAIELAERLAQIT
PAGLERVFLADNGSAAIEVALKMSFHYWLNQGAGQKTRFIALTGSYHGETLGALSVSDVA
LYRKTYAPLLLTPVLAPSPDAYEAEPGESAEACAARRLGELRVLLEQHAHETCAVIVEPL
VQCAGGMRMYHPSYLTGLRALCDEFGVHFIADEIAVGFGRTGTLFACEQAGVSPDFMCLS
KGLTGGFLPLSAVLTTTPVYEAFYAEYNAGKAFLHSHSYTGNPLACRAALATLDIFRDEP
VLERNRELAAHLARRLAPLREHPQVADVRQTGMIAAVELVRDKATRAPYPSEERRGLRVY
LHGLEHGALLRPLGNVVYFMPPYVVSTDELDHLVDVAIAGIERAIAD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory