Comparing N515DRAFT_1821 FitnessBrowser__Dyella79:N515DRAFT_1821 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
47% identity, 92% coverage: 1:218/238 of query aligns to 3:220/226 of 5xu1B
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
48% identity, 92% coverage: 1:218/238 of query aligns to 1:223/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
48% identity, 92% coverage: 1:218/238 of query aligns to 1:223/230 of 1l2tA
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
42% identity, 92% coverage: 19:238/238 of query aligns to 21:237/615 of 5lilA
Sites not aligning to the query:
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
42% identity, 92% coverage: 19:238/238 of query aligns to 21:237/592 of 5lj7A
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
43% identity, 92% coverage: 1:219/238 of query aligns to 4:222/648 of P75831
7arlD Lolcde in complex with lipoprotein and adp (see paper)
44% identity, 92% coverage: 1:219/238 of query aligns to 2:221/222 of 7arlD
7mdyC Lolcde nucleotide-bound
44% identity, 92% coverage: 1:219/238 of query aligns to 2:221/226 of 7mdyC
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
44% identity, 92% coverage: 1:219/238 of query aligns to 5:224/233 of P75957
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
44% identity, 92% coverage: 1:219/238 of query aligns to 4:223/229 of 7v8iD
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
46% identity, 92% coverage: 1:219/238 of query aligns to 3:217/223 of 2pclA
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
40% identity, 92% coverage: 1:219/238 of query aligns to 4:222/650 of 5ws4A
A5U7B7 Cell division ATP-binding protein FtsE from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) (see 2 papers)
42% identity, 92% coverage: 1:219/238 of query aligns to 1:217/229 of A5U7B7
8igqA Cryo-em structure of mycobacterium tuberculosis adp bound ftsex/ripc complex in peptidisc (see paper)
42% identity, 92% coverage: 1:219/238 of query aligns to 2:218/227 of 8igqA
8iddA Cryo-em structure of mycobacterium tuberculosis atp bound ftsex/ripc complex in peptidisc (see paper)
42% identity, 92% coverage: 1:219/238 of query aligns to 2:218/225 of 8iddA
3c4jA Abc protein artp in complex with atp-gamma-s
40% identity, 89% coverage: 20:232/238 of query aligns to 18:236/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
40% identity, 89% coverage: 20:232/238 of query aligns to 18:236/242 of 3c41J
Sites not aligning to the query:
2olkA Abc protein artp in complex with adp-beta-s
40% identity, 89% coverage: 20:232/238 of query aligns to 18:236/242 of 2olkA
Sites not aligning to the query:
2oljA Abc protein artp in complex with adp/mg2+
40% identity, 89% coverage: 20:232/238 of query aligns to 18:236/242 of 2oljA
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
39% identity, 92% coverage: 1:220/238 of query aligns to 1:221/343 of P30750
Sites not aligning to the query:
>N515DRAFT_1821 FitnessBrowser__Dyella79:N515DRAFT_1821
MLKMTHLSKVYRTEVVETYALRDFNIDVKEGEFVAVTGPSGSGKTTFLTIAGLLETFTGG
EYHLDGVEVSNLNDNARSKIRNEKIGFIFQAFNLIPDLNVYDNVEVPLRYRGMKALERKQ
RIMDALERVGLASRAKHYPAELSGGQQQRVAIARALAGSPRLLLADEPTGNLDTQMARGV
MELLEEIHREGATIVMVTHDPELATRAQRNVHVIDGQVVDLAEDPRFHQQQARAGAPA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory