SitesBLAST
Comparing N515DRAFT_1906 FitnessBrowser__Dyella79:N515DRAFT_1906 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3wirA Crystal structure of kojibiose phosphorylase complexed with glucose (see paper)
29% identity, 71% coverage: 45:783/1036 of query aligns to 22:756/756 of 3wirA
- active site: E483 (= E510)
- binding beta-D-glucopyranose: Y337 (= Y374), Y337 (= Y374), F342 (= F379), W343 (= W380), D344 (= D381), W391 (= W429), E392 (≠ R430), P402 (≠ A439), T417 (vs. gap), E483 (= E510), E483 (= E510), K596 (= K625), Q597 (= Q626)
- binding phosphate ion: Y337 (= Y374), S631 (= S660), S632 (≠ T661)
3wiqA Crystal structure of kojibiose phosphorylase complexed with kojibiose (see paper)
29% identity, 69% coverage: 45:762/1036 of query aligns to 22:734/751 of 3wiqA
- active site: E483 (= E510)
- binding beta-D-glucopyranose: Y337 (= Y374), W391 (= W429), E392 (≠ R430), T417 (vs. gap), E483 (= E510), K596 (= K625)
- binding alpha-D-glucopyranose: Y337 (= Y374), F342 (= F379), W343 (= W380), D344 (= D381), E483 (= E510), K596 (= K625), Q597 (= Q626)
- binding sulfate ion: Y337 (= Y374), S632 (≠ T661), H675 (= H704)
1h54B Maltose phosphorylase from lactobacillus brevis (see paper)
30% identity, 72% coverage: 28:773/1036 of query aligns to 9:740/754 of 1h54B
D6XZ22 1,2-alpha-glucosylglycerol phosphorylase; 2-O-alpha-glucosylglycerol phosphorylase; GGP; EC 2.4.1.332 from Bacillus selenitireducens (strain ATCC 700615 / DSM 15326 / MLS10) (see 2 papers)
28% identity, 71% coverage: 29:765/1036 of query aligns to 14:732/761 of D6XZ22
- Y327 (= Y374) mutation to F: Abolishes both phosphorylase and hydrolase activities.
- YQ 327:328 (≠ YE 374:375) binding
- WD 333:334 (= WD 380:381) binding
- W381 (= W429) mutation to F: Impaired phosphorylase activity without affecting the hydrolase activity.
- E475 (= E510) mutation E->A,Q: Loss of function.
- Y572 (≠ D604) mutation to F: Impairs both phosphorylase and hydrolase activities.
- K587 (= K625) mutation to A: Abolishes both phosphorylase and hydrolase activities.
- KQ 587:588 (= KQ 625:626) binding
4ktrA Crystal structure of 2-o-alpha-glucosylglycerol phosphorylase in complex with isofagomine and glycerol (see paper)
27% identity, 71% coverage: 29:765/1036 of query aligns to 14:732/762 of 4ktrA
4ktpB Crystal structure of 2-o-alpha-glucosylglycerol phosphorylase in complex with glucose (see paper)
28% identity, 71% coverage: 29:765/1036 of query aligns to 14:732/761 of 4ktpB
4ktpA Crystal structure of 2-o-alpha-glucosylglycerol phosphorylase in complex with glucose (see paper)
28% identity, 71% coverage: 29:765/1036 of query aligns to 14:732/767 of 4ktpA
4g9bA Crystal structure of beta-phosphoglucomutase homolog from escherichia coli, target efi-501172, with bound mg, open lid
47% identity, 19% coverage: 807:1006/1036 of query aligns to 4:203/227 of 4g9bA
- active site: D10 (= D813), L11 (= L814), D12 (= D815), T18 (= T821), K46 (= K849), S117 (= S918), V118 (≠ A919), K148 (= K949), E172 (= E973), D173 (= D974)
- binding magnesium ion: D10 (= D813), D12 (= D815), D173 (= D974)
2wf9A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate, and beryllium trifluoride, crystal form 2 (see paper)
43% identity, 20% coverage: 807:1014/1036 of query aligns to 2:210/221 of 2wf9A
- active site: D8 (= D813), L9 (= L814), D10 (= D815), T16 (= T821), K45 (= K849), S114 (= S918), A115 (= A919), K145 (= K949), E169 (= E973), D170 (= D974)
- binding beryllium trifluoride ion: D8 (= D813), L9 (= L814), D10 (= D815), S114 (= S918), A115 (= A919), K145 (= K949)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D815), H20 (= H825), G46 (= G850), V47 (= V851), R49 (= R853), S116 (= S920), K117 (≠ R921), N118 (= N922)
- binding 6-O-phosphono-alpha-D-glucopyranose: D10 (= D815), H20 (= H825), G46 (= G850), V47 (= V851), R49 (= R853), A115 (= A919), S116 (= S920), K117 (≠ R921), N118 (= N922)
- binding magnesium ion: D8 (= D813), D10 (= D815), D170 (= D974)
1o03A Structure of pentavalent phosphorous intermediate of an enzyme catalyzed phosphoryl transfer reaction observed on cocrystallization with glucose 6-phosphate (see paper)
43% identity, 20% coverage: 807:1014/1036 of query aligns to 2:210/221 of 1o03A
- active site: D8 (= D813), L9 (= L814), D10 (= D815), T16 (= T821), K45 (= K849), S114 (= S918), A115 (= A919), K145 (= K949), E169 (= E973), D170 (= D974)
- binding 1,6-di-O-phosphono-alpha-D-glucopyranose: D8 (= D813), L9 (= L814), D10 (= D815), H20 (= H825), G46 (= G850), V47 (= V851), R49 (= R853), S114 (= S918), A115 (= A919), S116 (= S920), K117 (≠ R921), K145 (= K949)
- binding magnesium ion: D8 (= D813), D10 (= D815), D170 (= D974)
1lvhA The structure of phosphorylated beta-phosphoglucomutase from lactoccocus lactis to 2.3 angstrom resolution (see paper)
43% identity, 20% coverage: 807:1014/1036 of query aligns to 2:210/221 of 1lvhA
- active site: D8 (= D813), L9 (= L814), D10 (= D815), T16 (= T821), K45 (= K849), S114 (= S918), A115 (= A919), K145 (= K949), E169 (= E973), D170 (= D974)
- binding magnesium ion: D8 (= D813), D10 (= D815), D170 (= D974)
6qzgA Beta-glucose 1,6-bisphosphonate bound to wild type beta- phosphoglucomutse in an open conformation.
43% identity, 20% coverage: 807:1014/1036 of query aligns to 2:210/219 of 6qzgA
- binding 3,7-anhydro-1,2,8-trideoxy-1,8-diphosphono-D-glycero-D-gulo-octitol: D8 (= D813), L9 (= L814), D10 (= D815), H20 (= H825), G46 (= G850), S114 (= S918), A115 (= A919), S116 (= S920), K117 (≠ R921), K145 (= K949)
- binding magnesium ion: D8 (= D813), D10 (= D815), D170 (= D974)
1z4nA Structure of beta-phosphoglucomutase with inhibitor bound alpha- galactose 1-phosphate cocrystallized with fluoride (see paper)
43% identity, 20% coverage: 807:1014/1036 of query aligns to 2:210/219 of 1z4nA
- active site: D8 (= D813), L9 (= L814), D10 (= D815), T16 (= T821), K45 (= K849), S114 (= S918), A115 (= A919), K145 (= K949), E169 (= E973), D170 (= D974)
- binding 1-O-phosphono-alpha-D-galactopyranose: H20 (= H825), W24 (= W829), V47 (= V851), R49 (= R853), S116 (= S920), K117 (≠ R921), N118 (= N922)
- binding magnesium ion: D8 (= D813), D10 (= D815), E169 (= E973), D170 (= D974)
5olwA 5-fluorotryptophan labeled beta-phosphoglucomutase in an open conformation (see paper)
43% identity, 20% coverage: 807:1014/1036 of query aligns to 2:210/224 of 5olwA
- active site: D8 (= D813), L9 (= L814), D10 (= D815), T16 (= T821), K45 (= K849), S114 (= S918), A115 (= A919), K145 (= K949), E169 (= E973), D170 (= D974)
- binding calcium ion: D8 (= D813), D10 (= D815), P89 (= P893), V92 (≠ L896), E124 (= E928), N127 (≠ G931), E169 (= E973), D170 (= D974), S171 (≠ A975)
6h91A Phosphorylated beta-phosphoglucomutase from lactococcus lactis in an open conformer to 2.4 a
43% identity, 20% coverage: 807:1014/1036 of query aligns to 2:210/218 of 6h91A
4c4rA Structure of beta-phosphoglucomutase in complex with a phosphonate analogue of beta-glucose-1-phosphate and magnesium trifluoride (see paper)
43% identity, 20% coverage: 807:1014/1036 of query aligns to 2:210/218 of 4c4rA
- active site: D8 (= D813), L9 (= L814), D10 (= D815), T16 (= T821), K45 (= K849), S114 (= S918), A115 (= A919), K145 (= K949), E169 (= E973), D170 (= D974)
- binding magnesium ion: D8 (= D813), D10 (= D815), D170 (= D974)
- binding trifluoromagnesate: D8 (= D813), L9 (= L814), D10 (= D815), S114 (= S918), A115 (= A919), K145 (= K949)
- binding (1R)-1,5-anhydro-1-(phosphonomethyl)-D-glucitol: D10 (= D815), H20 (= H825), W24 (= W829), L44 (= L848), G46 (= G850), V47 (= V851), R49 (= R853), S52 (= S856), S116 (= S920), K117 (≠ R921)
3zi4A The structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate and scandium tetrafluoride
43% identity, 20% coverage: 807:1014/1036 of query aligns to 2:210/218 of 3zi4A
- active site: D8 (= D813), L9 (= L814), D10 (= D815), T16 (= T821), K45 (= K849), S114 (= S918), A115 (= A919), K145 (= K949), E169 (= E973), D170 (= D974)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D815), H20 (= H825), G46 (= G850), V47 (= V851), R49 (= R853), S116 (= S920), K117 (≠ R921)
- binding magnesium ion: D8 (= D813), D10 (= D815), D170 (= D974)
- binding Scandium Tetrafluoride: D8 (= D813), L9 (= L814), D10 (= D815), S114 (= S918), A115 (= A919), K145 (= K949)
2wf8A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate, glucose-1-phosphate and beryllium trifluoride (see paper)
43% identity, 20% coverage: 807:1014/1036 of query aligns to 2:210/218 of 2wf8A
- active site: D8 (= D813), L9 (= L814), D10 (= D815), T16 (= T821), K45 (= K849), S114 (= S918), A115 (= A919), K145 (= K949), E169 (= E973), D170 (= D974)
- binding beryllium trifluoride ion: D8 (= D813), L9 (= L814), D10 (= D815), S114 (= S918), A115 (= A919), K145 (= K949)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D815), H20 (= H825), G46 (= G850), V47 (= V851), R49 (= R853), A115 (= A919), S116 (= S920), K117 (≠ R921)
- binding 1-O-phosphono-alpha-D-glucopyranose: D10 (= D815), H20 (= H825), W24 (= W829), L44 (= L848), G46 (= G850), V47 (= V851), R49 (= R853), S52 (= S856), A115 (= A919), S116 (= S920), K117 (≠ R921)
- binding magnesium ion: D8 (= D813), D10 (= D815), D170 (= D974)
2wf7A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphonate and aluminium tetrafluoride (see paper)
43% identity, 20% coverage: 807:1014/1036 of query aligns to 2:210/218 of 2wf7A
- active site: D8 (= D813), L9 (= L814), D10 (= D815), T16 (= T821), K45 (= K849), S114 (= S918), A115 (= A919), K145 (= K949), E169 (= E973), D170 (= D974)
- binding tetrafluoroaluminate ion: D8 (= D813), L9 (= L814), D10 (= D815), S114 (= S918), K145 (= K949)
- binding 6,7-dideoxy-7-phosphono-beta-D-gluco-heptopyranose: D10 (= D815), G46 (= G850), V47 (= V851), R49 (= R853), S116 (= S920), K117 (≠ R921), N118 (= N922)
- binding magnesium ion: D8 (= D813), D10 (= D815), D170 (= D974)
2wf6A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate and aluminium tetrafluoride (see paper)
43% identity, 20% coverage: 807:1014/1036 of query aligns to 2:210/218 of 2wf6A
- active site: D8 (= D813), L9 (= L814), D10 (= D815), T16 (= T821), K45 (= K849), S114 (= S918), A115 (= A919), K145 (= K949), E169 (= E973), D170 (= D974)
- binding tetrafluoroaluminate ion: D8 (= D813), L9 (= L814), D10 (= D815), S114 (= S918), K145 (= K949)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D815), G46 (= G850), V47 (= V851), R49 (= R853), S116 (= S920), K117 (≠ R921)
- binding magnesium ion: D8 (= D813), D10 (= D815), D170 (= D974)
Query Sequence
>N515DRAFT_1906 FitnessBrowser__Dyella79:N515DRAFT_1906
MLDRLASAPAAAVDVVPTSGVGTGMTDPWTLIRRGTDPAGFAQDESLFALANGALGVRGG
LEEGDSPSQASFLSAAWERTPIEYHERFPGFAAHTDTRIPVADATRIQLRLGDVPVRLAE
GEWLDFERRLDLREGCYRRFLRWRSPAGETLEIEAERIVSLDEPGLLALRYRVRSVDYTG
PVTLESAISTARDAAEQGDDPRIGTRLDGGLHTVDAAAEPDFAWVRQQTTHSGIRLACAQ
AHRAQDGGLDCHFANLAQHGVVHSYTGMLTPGQAVTLEKYVAYAWTEPHGDDADDALLAR
TRGILEAAAHLRYAGLLERQRQALAPLWDGADLAIDGDAATEQALRFNLFHLFQSSCRDG
QGSAAAKGLTGEGYEGHYFWDAEAFILPVLATVAPELARGMLLYRHRILDRSRRHARELN
HPRGALYAWRTISGDECSAYYPGGSAQYHINAAIAWAISLYVDASGDTDFLRDHGAEILF
ETARVWLDIGHFNARRGDAFCIHEVTGPDEYSALVDNNHYTNRMAQRHLRDAAATALWMA
GAAPVEYGALCARIGLGEDEVAQWRRAAEAMYLPEDPRLGVFPQDDGFLDRPRLPDHLAA
KPGDGKHPLLLRLHPLTIYRHQVCKQADTLLALMLAGDGVERAAKRRNFDYYESVTVHDS
TLSASTFGVIAAEVGLAAKAWRYFQDSLRVDLDDSHGNAAHGVHMAAMAGSWLGLVWGFG
GFRTIDGQPALAPRLPAAWHGYRFGLRWGRAQLRVEVDASGVRYTLLRGDTLAFRHDGRE
HTIHAGQTLRLPRADAIPNRRAPQPALQAVIFDLDGVIADTAVVHDAAWRRLAQETGLPF
DASIGERLKGVDRMGSLDILLERAGRAYSAEEKLALGERKNDYYREQIQRFGPDQLLPGA
RAAIAAVRAAGLKVGLASASRNAPLLLERLGVAHLFDYIVDAAHIQRSKPDPEIFLAAAA
GLGVAPAACLGVEDAAAGVASIHAAGMAAVGIGQPSALAQAETVLPGLSAFRIEDFISSE
EASRAASGEAASDIAT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory