SitesBLAST
Comparing N515DRAFT_1919 FitnessBrowser__Dyella79:N515DRAFT_1919 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3lkiB Crystal structure of fructokinase with bound atp from xylella fastidiosa
56% identity, 100% coverage: 1:326/326 of query aligns to 1:321/322 of 3lkiB
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
35% identity, 97% coverage: 9:323/326 of query aligns to 8:306/306 of 5eynA
- active site: G246 (≠ A255), A247 (= A256), G248 (= G257), D249 (= D258)
- binding adenosine-5'-diphosphate: H91 (= H98), T217 (= T226), G219 (= G228), A220 (≠ S229), A238 (= A247), V239 (= V248), T244 (≠ S253), G246 (≠ A255), A247 (= A256), G248 (= G257), F251 (= F260), N279 (≠ A296), G282 (= G299), A283 (= A300)
- binding beryllium trifluoride ion: G246 (≠ A255), G248 (= G257), D249 (= D258)
- binding beta-D-fructofuranose: D9 (≠ E10), D13 (= D14), G28 (= G35), A29 (= A36), N32 (= N39), F96 (= F103), F98 (= F105), R159 (= R168), D249 (= D258)
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
35% identity, 97% coverage: 9:323/326 of query aligns to 12:310/310 of 5yggA
- binding adenosine-5'-diphosphate: K188 (= K193), T221 (= T226), G223 (= G228), A242 (= A247), V243 (= V248), F255 (= F260), N283 (≠ A296), G286 (= G299), A287 (= A300)
- binding beta-D-fructofuranose: D13 (≠ E10), D17 (= D14), G32 (= G35), A33 (= A36), F100 (= F103), F102 (= F105), R163 (= R168), D253 (= D258)
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
34% identity, 99% coverage: 3:326/326 of query aligns to 5:311/319 of Q8ZKR2
- D16 (= D14) binding
- G31 (= G35) binding
- Y101 (≠ F105) binding
- R162 (= R168) binding
- A180 (≠ L186) binding
- A181 (≠ H187) binding
- A183 (= A189) binding
- G213 (= G207) binding
- D246 (= D252) binding
- T248 (= T254) binding
- D252 (= D258) binding
- A287 (≠ T302) binding
- A290 (≠ R305) binding
- G292 (= G307) binding
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
33% identity, 99% coverage: 3:325/326 of query aligns to 1:299/299 of 1tz3A
- active site: C24 (≠ F32), F88 (= F103), G238 (≠ A255), A239 (= A256), G240 (= G257), D241 (= D258)
- binding 5-aminoimidazole ribonucleoside: D8 (≠ E10), S10 (≠ L12), D12 (= D14), G27 (= G35), L83 (≠ A91), F88 (= F103), Y90 (≠ F105), R151 (= R168), M154 (≠ L171), D241 (= D258)
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
33% identity, 98% coverage: 3:322/326 of query aligns to 1:296/297 of 1tz6A
- active site: C24 (≠ F32), F88 (= F103), G238 (≠ A255), A239 (= A256), G240 (= G257), D241 (= D258)
- binding phosphomethylphosphonic acid adenylate ester: N149 (= N166), K176 (= K193), E181 (= E198), S209 (≠ R214), G211 (≠ W216), A212 (= A217), G214 (≠ R219), A239 (= A256), G240 (= G257), F243 (= F260), N270 (≠ A296), G273 (= G299), A274 (= A300)
- binding 5-aminoimidazole ribonucleoside: D8 (≠ E10), D12 (= D14), G27 (= G35), F88 (= F103), Y90 (≠ F105), R151 (= R168), M154 (≠ L171), D241 (= D258)
F4I0K2 Fructokinase-like 2, chloroplastic; pfkB-type carbohydrate kinase family protein 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 92% coverage: 2:301/326 of query aligns to 204:532/614 of F4I0K2
- C208 (≠ L6) mutation to A: Strongly reduces the interaction with CITRX.
- CC 208:209 (≠ LC 6:7) mutation to AA: Abolishes interaction with CITRX.
- C209 (= C7) mutation to A: Strongly reduces the interaction with CITRX.
Q9M394 Fructokinase-like 1, chloroplastic; PEP-associated protein 6; pfkB-type carbohydrate kinase family protein 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 93% coverage: 14:316/326 of query aligns to 128:456/471 of Q9M394
Sites not aligning to the query:
- 105 C→A: Does not affect the interaction with CITRX.
- 105:106 CC→AA: Abolishes interaction with CITRX.
- 106 C→A: Strongly reduces the interaction with CITRX.
4wjmA Crystal structure of fructokinase from brucella abortus 2308 with bound amppnp
30% identity, 93% coverage: 5:308/326 of query aligns to 8:304/312 of 4wjmA
- active site: G252 (≠ A255), A253 (= A256), G254 (= G257), D255 (= D258)
- binding phosphoaminophosphonic acid-adenylate ester: T223 (= T226), G225 (= G228), A226 (≠ S229), G228 (≠ T231), G252 (≠ A255), A253 (= A256), G254 (= G257), V257 (≠ F260), V292 (≠ A296), A295 (≠ G299)
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
30% identity, 80% coverage: 5:265/326 of query aligns to 2:252/302 of 3gbuA
Sites not aligning to the query:
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
30% identity, 80% coverage: 5:265/326 of query aligns to 3:253/304 of 3ih0A
Sites not aligning to the query:
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
26% identity, 99% coverage: 4:325/326 of query aligns to 3:308/308 of 3iq0B
- active site: G252 (≠ A255), A253 (= A256), G254 (= G257), D255 (= D258)
- binding adenosine-5'-triphosphate: S192 (= S195), K223 (≠ T226), G225 (= G228), E247 (≠ T250), A253 (= A256), G254 (= G257), F257 (= F260), N279 (≠ A296), G282 (= G299)
6a8cA Ribokinase from leishmania donovani with adp (see paper)
27% identity, 97% coverage: 4:320/326 of query aligns to 15:324/327 of 6a8cA
- binding adenosine-5'-diphosphate: G245 (= G228), A246 (≠ S229), T271 (≠ S253), A274 (= A256), G275 (= G257), N300 (≠ A296), A303 (≠ G299)
- binding glycerol: D25 (= D14), S42 (≠ P26), S44 (= S28), G50 (= G34), G51 (= G35), N55 (= N39)
6a8bA Ribokinase from leishmania donovani with amppcp (see paper)
27% identity, 97% coverage: 4:320/326 of query aligns to 15:324/327 of 6a8bA
- binding phosphomethylphosphonic acid adenylate ester: G245 (= G228), A246 (≠ S229), T271 (≠ S253), A274 (= A256), G275 (= G257), N300 (≠ A296), A303 (≠ G299), V307 (= V303)
- binding glycerol: D25 (= D14), G50 (= G34), G51 (= G35), N55 (= N39), N157 (= N136), I159 (≠ M138), E190 (≠ Q175)
6a8aA Ribokinase from leishmania donovani with atp (see paper)
27% identity, 97% coverage: 4:320/326 of query aligns to 15:324/327 of 6a8aA
- binding adenosine-5'-triphosphate: N207 (≠ V192), T243 (= T226), G245 (= G228), A246 (≠ S229), G248 (≠ W234), T271 (≠ S253), G273 (≠ A255), A274 (= A256), G275 (= G257), N300 (≠ A296), A303 (≠ G299), V307 (= V303)
- binding glycerol: D25 (= D14), G50 (= G34), G51 (= G35), N55 (= N39)
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
27% identity, 92% coverage: 27:326/326 of query aligns to 31:306/306 of 4xckA
- active site: A249 (= A255), A250 (= A256), G251 (= G257), D252 (= D258)
- binding adenosine-5'-diphosphate: T220 (= T226), G222 (= G228), S223 (= S229), V242 (= V248), T247 (≠ S253), A250 (= A256), F254 (= F260), H276 (≠ A296), A279 (≠ G299), V283 (= V303)
- binding alpha-D-ribofuranose: G39 (= G35), K40 (≠ A36), N43 (= N39), A95 (= A91), I107 (≠ F103), I109 (≠ F105), E140 (= E145), T248 (= T254), D252 (= D258)
Sites not aligning to the query:
8cqxA Ribokinase from t.Sp mutant a92g
33% identity, 93% coverage: 19:321/326 of query aligns to 28:299/300 of 8cqxA
- binding adenosine-5'-diphosphate: N179 (≠ V192), T217 (= T226), G219 (= G228), A220 (≠ S229), G222 (≠ T231), F250 (= F260), N272 (≠ A296), G275 (= G299), A276 (= A300), T279 (≠ V303)
- binding magnesium ion: D242 (= D252), T244 (= T254), A278 (≠ T302), S287 (≠ A311)
7fcaD Pfkb(mycobacterium marinum) (see paper)
30% identity, 93% coverage: 6:308/326 of query aligns to 5:282/282 of 7fcaD
7ag6A Crystal structure of sf kinase yihv from e. Coli in complex with sulfofructose (sf), adp-mg (see paper)
26% identity, 98% coverage: 5:322/326 of query aligns to 4:294/302 of 7ag6A
- binding adenosine-5'-diphosphate: T212 (= T226), G214 (= G228), G217 (≠ T231), A242 (= A256), G243 (= G257), S268 (≠ A296), A271 (≠ G299), C275 (≠ V303)
- binding 6-deoxy-6-sulfo-D-fructose: I9 (≠ E10), V11 (≠ L12), D13 (= D14), G39 (= G35), P40 (≠ A36), S95 (≠ A91), N109 (≠ F105), R138 (≠ A142), D244 (= D258)
7agkA Crystal structure of e. Coli sf kinase (yihv) in complex with product sulfofructose phosphate (sfp) (see paper)
26% identity, 98% coverage: 5:322/326 of query aligns to 4:294/298 of 7agkA
- binding [(2~{S},3~{S},4~{S},5~{R})-3,4,5-tris(oxidanyl)-5-(phosphonooxymethyl)oxolan-2-yl]methanesulfonic acid: V11 (≠ L12), D13 (= D14), G39 (= G35), P40 (≠ A36), S95 (≠ A91), N109 (≠ F105), R138 (≠ A142), D244 (= D258)
Query Sequence
>N515DRAFT_1919 FitnessBrowser__Dyella79:N515DRAFT_1919
MPRNILCFGEALIDFHAEGRDAQGFPRSFIPFAGGAPANVSVAVARLGGPAAFAGMLGQD
MFGDFLLDSLRRAGVDTAGVARTGEANTALAFVALDSHGERSFSFYRPPSADLLFRPEHF
RAESFRGAAVFHVCSNSMTEPALAEATREGMRRAHTAGAWVSFDLNLRPALWPNQSASHD
ELWPALHLADVVKLSAEEFHWLAGDEGEEATLDRLWAGRARLLVVTDGSRTLRWFHPDAS
GEMPVYAVPTVDSTAAGDAFVGGLLHRLATVEKGADQLDHLVAELPRLHAMLRFAAACGA
LTVTRLGSFAAMPDEAEVLAFMDSHA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory