Comparing N515DRAFT_2068 FitnessBrowser__Dyella79:N515DRAFT_2068 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
3k0tC Crystal structure of pspto -psp protein in complex with d-beta-glucose from pseudomonas syringae pv. Tomato str. Dc3000 (see paper)
62% identity, 98% coverage: 3:127/127 of query aligns to 1:124/124 of 3k0tC
A0A1J1DL12 2-iminobutanoate/2-iminopropanoate deaminase; Allergen Der f 34; Enamine/imine deaminase; Allergen Der f 34.0101; EC 3.5.99.10 from Dermatophagoides farinae (American house dust mite) (see paper)
49% identity, 98% coverage: 3:127/127 of query aligns to 4:128/128 of A0A1J1DL12
Sites not aligning to the query:
2b33B Crystal structure of a putative endoribonuclease (tm0215) from thermotoga maritima msb8 at 2.30 a resolution
50% identity, 97% coverage: 3:125/127 of query aligns to 1:123/126 of 2b33B
5v4dA Crystal structure of the protein of unknown function of the conserved rid protein family yyfa from yersinia pestis
49% identity, 95% coverage: 3:123/127 of query aligns to 3:124/127 of 5v4dA
Q94JQ4 Reactive Intermediate Deaminase A, chloroplastic; 2-iminobutanoate/2-iminopropanoate deaminase; EC 3.5.99.10 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
46% identity, 95% coverage: 3:123/127 of query aligns to 64:184/187 of Q94JQ4
P80601 2-iminobutanoate/2-iminopropanoate deaminase; 14.3 kDa perchloric acid soluble protein; Translation inhibitor L-PSP ribonuclease; UK114 antigen; EC 3.5.99.10; EC 3.1.-.- from Capra hircus (Goat) (see paper)
46% identity, 98% coverage: 1:125/127 of query aligns to 4:128/137 of P80601
Sites not aligning to the query:
7cd4A Crystal structure of the s103f mutant of bacillus subtilis (natto) yabj protein. (see paper)
47% identity, 95% coverage: 6:126/127 of query aligns to 4:123/124 of 7cd4A
P52759 2-iminobutanoate/2-iminopropanoate deaminase; Liver perchloric acid-soluble protein; L-PSP; Reactive intermediate imine deaminase A homolog; Translation inhibitor L-PSP ribonuclease; UK114 antigen homolog; rp14.5; EC 3.5.99.10 from Rattus norvegicus (Rat) (see paper)
45% identity, 98% coverage: 1:125/127 of query aligns to 4:128/137 of P52759
Sites not aligning to the query:
3vczB 1.80 angstrom resolution crystal structure of a putative translation initiation inhibitor from vibrio vulnificus cmcp6
49% identity, 96% coverage: 4:125/127 of query aligns to 2:126/127 of 3vczB
2uynA Crystal structure of e. Coli tdcf with bound 2-ketobutyrate (see paper)
44% identity, 97% coverage: 3:125/127 of query aligns to 1:125/127 of 2uynA
2uykC Crystal structure of e. Coli tdcf with bound serine (see paper)
44% identity, 97% coverage: 3:125/127 of query aligns to 1:125/127 of 2uykC
Q7CP78 2-iminobutanoate/2-iminopropanoate deaminase; Enamine/imine deaminase; EC 3.5.99.10 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
46% identity, 94% coverage: 6:125/127 of query aligns to 5:126/128 of Q7CP78
5hp8A Crystal structures of rida in complex with pyruvate (see paper)
44% identity, 83% coverage: 19:123/127 of query aligns to 1:105/108 of 5hp8A
P0AFQ5 3-aminoacrylate deaminase RutC; 3-AA deaminase; EC 3.5.-.- from Escherichia coli (strain K12) (see paper)
32% identity, 94% coverage: 1:120/127 of query aligns to 1:120/128 of P0AFQ5
3lybB Structure of putative endoribonuclease(kp1_3112) from klebsiella pneumoniae
24% identity, 86% coverage: 18:126/127 of query aligns to 1:136/137 of 3lybB
>N515DRAFT_2068 FitnessBrowser__Dyella79:N515DRAFT_2068
MTRSIISTDKAPAAIGPYSQAVRAGNTVYFSGQIPLDPATGNLVQGDIALQTRRVFDNLK
AVAEAAGSSLSAIVRVGIYVTDLANFATVNAVMAEYFQAPYPARSTIQVSALPKGAEVEV
DAVLVID
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory