Comparing N515DRAFT_2124 FitnessBrowser__Dyella79:N515DRAFT_2124 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4xg1B Psychromonas ingrahamii diaminopimelate decarboxylase with llp
45% identity, 94% coverage: 17:418/426 of query aligns to 12:414/418 of 4xg1B
B4XMC6 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Helicobacter pylori (Campylobacter pylori) (see paper)
46% identity, 90% coverage: 32:413/426 of query aligns to 13:394/405 of B4XMC6
3c5qA Crystal structure of diaminopimelate decarboxylase (i148l mutant) from helicobacter pylori complexed with l-lysine
46% identity, 90% coverage: 32:413/426 of query aligns to 11:386/394 of 3c5qA
4xg1A Psychromonas ingrahamii diaminopimelate decarboxylase with llp
42% identity, 94% coverage: 17:418/426 of query aligns to 10:389/393 of 4xg1A
1twiA Crystal structure of diaminopimelate decarboxylase from m. Jannaschii in co-complex with l-lysine (see paper)
37% identity, 94% coverage: 17:415/426 of query aligns to 15:425/434 of 1twiA
Q58497 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
37% identity, 94% coverage: 17:415/426 of query aligns to 19:429/438 of Q58497
1tufA Crystal structure of diaminopimelate decarboxylase from m. Jannaschi (see paper)
37% identity, 94% coverage: 17:415/426 of query aligns to 15:425/434 of 1tufA
Q9X1K5 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
39% identity, 92% coverage: 23:413/426 of query aligns to 4:380/386 of Q9X1K5
2yxxA Crystal structure analysis of diaminopimelate decarboxylate (lysa)
39% identity, 92% coverage: 23:413/426 of query aligns to 3:379/385 of 2yxxA
6n2aA Meso-diaminopimelate decarboxylase from arabidopsis thaliana (isoform 1)
34% identity, 89% coverage: 33:412/426 of query aligns to 31:414/422 of 6n2aA
P00861 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Escherichia coli (strain K12)
36% identity, 91% coverage: 22:410/426 of query aligns to 16:411/420 of P00861
1ko0A Crystal structure of a d,l-lysine complex of diaminopimelate decarboxylase
36% identity, 91% coverage: 22:410/426 of query aligns to 15:410/419 of 1ko0A
1knwA Crystal structure of diaminopimelate decarboxylase
36% identity, 91% coverage: 22:410/426 of query aligns to 15:410/421 of 1knwA
P9WIU7 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
33% identity, 93% coverage: 20:417/426 of query aligns to 28:445/447 of P9WIU7
1hkvA Mycobacterium diaminopimelate dicarboxylase (lysa) (see paper)
33% identity, 93% coverage: 20:417/426 of query aligns to 27:444/446 of 1hkvA
5x7nA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
31% identity, 93% coverage: 20:417/426 of query aligns to 29:442/442 of 5x7nA
5x7mA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
31% identity, 93% coverage: 20:417/426 of query aligns to 29:442/443 of 5x7mA
7ru7A Crystal structure of btrk, a decarboxylase involved in butirosin biosynthesis
28% identity, 94% coverage: 18:417/426 of query aligns to 3:410/412 of 7ru7A
8d5rA Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- ornithine (see paper)
30% identity, 93% coverage: 17:414/426 of query aligns to 31:452/461 of 8d5rA
8d5dA Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- arginine (see paper)
30% identity, 93% coverage: 17:414/426 of query aligns to 30:450/458 of 8d5dA
>N515DRAFT_2124 FitnessBrowser__Dyella79:N515DRAFT_2124
MQHSKLPADDSPNPDALFDGVDLRRLAERIPTPFHAYSANAIRTRIAGLQQALHGFDALL
CYAVKANSNLAILQLMAEAGVGADIVSSGELWRALHAGIPAQRIVFSGVGKTAAEIAEAL
AAGILRFNVESADELELLQRMAAELHVVAHAAVRINPDVDAQTHAKISTGKAENKFGVSI
DEARRWFADSARQANVRLDGLHVHIGSQILSVEPFRLAFARVAAFWRELEAAGHAIASID
VGGGLGVRYRDGQVPIPPGDYAAAIREALAGFRGRLLLEPGRYLVAEAGVLLTRVVRVKH
GERRRFLVLDAAMNDLLRPSLYDAWHDIVPLLDDARPPHRYDVVGPVCETGDTFAVEREL
PELHAGELVLIRTTGAYGAAMASTYNSRPLAAEVLLDRGRHAIVRRRQSLEDMVAGEQPA
RHWETA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory