Comparing N515DRAFT_2186 FitnessBrowser__Dyella79:N515DRAFT_2186 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A959 Glutamate-pyruvate aminotransferase AlaA; EC 2.6.1.2 from Escherichia coli (strain K12) (see paper)
43% identity, 97% coverage: 2:398/410 of query aligns to 4:400/405 of P0A959
4cvqA Crystal structure of an aminotransferase from escherichia coli at 2. 11 angstroem resolution (see paper)
43% identity, 97% coverage: 2:398/410 of query aligns to 4:400/404 of 4cvqA
1xi9C Alanine aminotransferase from pyrococcus furiosus pfu-1397077-001
35% identity, 96% coverage: 3:397/410 of query aligns to 1:390/393 of 1xi9C
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
31% identity, 96% coverage: 5:397/410 of query aligns to 11:382/384 of 1o4sB
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
31% identity, 90% coverage: 28:397/410 of query aligns to 21:382/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
31% identity, 90% coverage: 28:397/410 of query aligns to 21:382/388 of 1gd9A
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
31% identity, 93% coverage: 18:399/410 of query aligns to 18:384/385 of Q56232
Sites not aligning to the query:
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
31% identity, 93% coverage: 18:397/410 of query aligns to 18:382/382 of 1b5oA
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
31% identity, 93% coverage: 18:397/410 of query aligns to 18:382/382 of 1gc4A
1gc3A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan (see paper)
31% identity, 93% coverage: 18:397/410 of query aligns to 18:382/382 of 1gc3A
Sites not aligning to the query:
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
31% identity, 93% coverage: 18:397/410 of query aligns to 18:382/382 of 1bkgA
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
31% identity, 93% coverage: 18:397/410 of query aligns to 18:382/382 of 1bjwA
P17735 Tyrosine aminotransferase; TAT; L-tyrosine:2-oxoglutarate aminotransferase; EC 2.6.1.5 from Homo sapiens (Human) (see paper)
27% identity, 99% coverage: 2:405/410 of query aligns to 43:449/454 of P17735
3dydA Human tyrosine aminotransferase
27% identity, 89% coverage: 33:395/410 of query aligns to 17:380/388 of 3dydA
P04694 Tyrosine aminotransferase; TAT; L-tyrosine:2-oxoglutarate aminotransferase; EC 2.6.1.5 from Rattus norvegicus (Rat) (see 2 papers)
27% identity, 91% coverage: 33:405/410 of query aligns to 73:449/454 of P04694
Sites not aligning to the query:
P58350 Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
27% identity, 93% coverage: 22:401/410 of query aligns to 32:410/410 of P58350
3tcmA Crystal structure of alanine aminotransferase from hordeum vulgare (see paper)
31% identity, 81% coverage: 61:393/410 of query aligns to 105:467/479 of 3tcmA
Sites not aligning to the query:
6f35A Crystal structure of the aspartate aminotranferase from rhizobium meliloti (see paper)
27% identity, 93% coverage: 22:401/410 of query aligns to 22:400/400 of 6f35A
Q93703 Tyrosine aminotransferase; TAT; L-tyrosine:2-oxoglutarate aminotransferase; EC 2.6.1.5 from Caenorhabditis elegans (see 3 papers)
27% identity, 90% coverage: 33:399/410 of query aligns to 76:440/464 of Q93703
P14909 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 3 papers)
26% identity, 94% coverage: 14:400/410 of query aligns to 13:398/402 of P14909
Sites not aligning to the query:
>N515DRAFT_2186 FitnessBrowser__Dyella79:N515DRAFT_2186
MIRPSAHLAEVRYEIRGALTRRSRELEAAGLPIIKLNIGNPGRYGFETPPHLRDAIAAHL
RDSEAYGHEQGLEEARETIAAQQRARGARGVEVERIFVGNGVSELIDLSLRALLQPGDEV
LLPSPDYPLWSAATILNDGQPRYYRCLAENGHLPDPDEIEALVTARTRAIVLINPNNPTG
AVYPRELLERIVRIAERHHLLLLTDEIYDEILYDGAQFVPLATVAGDVPCVSFGGLSKVH
RACGYRVGWMSLSGDPVRTHDYRDALQLLAALRLCANVTAQWAVRPALESKPTIGALTSP
GGRLHEARRMILEGVANSEFLDLATPGGALYAFPRVRADRVPRFDDNAFALRLLEEESVL
VVPGSSFNVPDSRHLRLTLLPPPEQLREVFVRIERVLARMAEGQHARAVA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory