SitesBLAST
Comparing N515DRAFT_2198 FitnessBrowser__Dyella79:N515DRAFT_2198 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9ZW19 Tropinone reductase homolog At2g29360; EC 1.1.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
44% identity, 90% coverage: 28:280/280 of query aligns to 14:265/271 of Q9ZW19
- S209 (≠ A224) mutation to Y: Loss of activity with quinuclidinone and decreased activity with cyclohexanones.
A7DY56 Tropinone reductase; EC 1.1.1.206; EC 1.1.1.236 from Cochlearia officinalis (Common scurvygrass) (see paper)
42% identity, 90% coverage: 28:280/280 of query aligns to 14:265/273 of A7DY56
- Y209 (≠ A224) mutation to S: Loss of tropinone or nortropinone reduction, but faster reduction of cyclohexanones.
5fffA Noroxomaritidine/norcraugsodine reductase in complex with NADP+ and piperonal (see paper)
41% identity, 88% coverage: 28:274/280 of query aligns to 7:252/257 of 5fffA
- active site: K206 (≠ D228)
- binding 1,3-benzodioxole-5-carbaldehyde: Y100 (≠ N122), H158 (≠ G180)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G39), T20 (≠ S41), G22 (= G43), I23 (= I44), R43 (= R64), C67 (≠ A90), D68 (= D91), V69 (≠ L92), N96 (= N118), I146 (≠ V168), Y161 (= Y183), K165 (= K187), P191 (= P213), A193 (≠ Y215), I194 (= I216), T196 (= T218), G198 (≠ R220), T199 (≠ S221)
5ff9B Noroxomaritidine/norcraugsodine reductase in complex with NADP+ and tyramine (see paper)
41% identity, 88% coverage: 28:274/280 of query aligns to 7:252/257 of 5ff9B
- active site: K206 (≠ D228)
- binding 4-(2-aminoethyl)phenol: Y100 (≠ N122), I155 (≠ V177), H158 (≠ G180)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G39), T20 (≠ S41), K21 (= K42), I23 (= I44), S42 (≠ A63), R43 (= R64), C67 (≠ A90), D68 (= D91), V69 (≠ L92), N96 (= N118), I146 (≠ V168), S148 (= S170), Y161 (= Y183), K165 (= K187), P191 (= P213), A193 (≠ Y215), I194 (= I216), T196 (= T218), G198 (≠ R220), T199 (≠ S221)
A0A1A9TAK5 Noroxomaritidine/norcraugsodine reductase; NorRed; EC 1.1.1.- from Narcissus pseudonarcissus (Daffodil) (see paper)
41% identity, 88% coverage: 28:274/280 of query aligns to 7:252/257 of A0A1A9TAK5
P50163 Tropinone reductase 2; Tropinone reductase II; TR-II; EC 1.1.1.236 from Datura stramonium (Jimsonweed) (Common thornapple) (see paper)
42% identity, 90% coverage: 28:280/280 of query aligns to 5:260/260 of P50163
- 18:41 (vs. 41:64, 50% identical) binding
- S146 (= S170) binding
- IATSL 192:196 (≠ IRTQR 216:220) binding
2ae2A Tropinone reductase-ii complexed with NADP+ and pseudotropine (see paper)
42% identity, 90% coverage: 28:280/280 of query aligns to 4:259/259 of 2ae2A
- active site: G19 (= G43), S145 (= S170), Y158 (= Y183), K162 (= K187)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G39), S17 (= S41), R18 (≠ K42), G19 (= G43), I20 (= I44), S39 (≠ A63), R40 (= R64), C64 (≠ A90), L66 (= L92), N93 (= N118), G95 (= G120), I116 (≠ L141), I143 (≠ V168), S145 (= S170), Y158 (= Y183), K162 (= K187), P188 (= P213), G189 (≠ W214), V190 (≠ Y215), I191 (= I216), T193 (= T218), S194 (≠ Q219), L195 (≠ R220), V196 (≠ S221)
- binding pseudotropine: S145 (= S170), E155 (≠ G180), Y158 (= Y183), L195 (≠ R220)
1ipfA Tropinone reductase-ii complexed with NADPH and tropinone (see paper)
42% identity, 90% coverage: 28:280/280 of query aligns to 4:259/259 of 1ipfA
- active site: G19 (= G43), S145 (= S170), Y158 (= Y183), K162 (= K187)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G39), R18 (≠ K42), G19 (= G43), I20 (= I44), S39 (≠ A63), R40 (= R64), C64 (≠ A90), D65 (= D91), L66 (= L92), N93 (= N118), S145 (= S170), Y158 (= Y183), K162 (= K187), P188 (= P213), V190 (≠ Y215), I191 (= I216), T193 (= T218), S194 (≠ Q219), L195 (≠ R220), V196 (≠ S221)
- binding 8-methyl-8-azabicyclo[3,2,1]octan-3-one: S147 (= S172), E155 (≠ G180), Y158 (= Y183)
1ipeA Tropinone reductase-ii complexed with NADPH (see paper)
42% identity, 90% coverage: 28:280/280 of query aligns to 4:259/259 of 1ipeA
- active site: G19 (= G43), S145 (= S170), Y158 (= Y183), K162 (= K187)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G39), S17 (= S41), R18 (≠ K42), G19 (= G43), I20 (= I44), S39 (≠ A63), R40 (= R64), C64 (≠ A90), D65 (= D91), L66 (= L92), N93 (= N118), I116 (≠ L141), S145 (= S170), Y158 (= Y183), K162 (= K187), P188 (= P213), I191 (= I216), T193 (= T218), S194 (≠ Q219), L195 (≠ R220), V196 (≠ S221)
P50162 Tropinone reductase 1; Tropine dehydrogenase; Tropinone reductase I; TR-I; EC 1.1.1.206 from Datura stramonium (Jimsonweed) (Common thornapple) (see paper)
40% identity, 95% coverage: 16:280/280 of query aligns to 4:273/273 of P50162
- 25:49 (vs. 36:60, 68% identical) binding
- S158 (= S170) binding
- Y171 (= Y183) active site, Proton acceptor
6y4dA Crystal structure of a short-chain dehydrogenase/reductase (sdr) from zephyranthes treatiae in complex with NADP+ (see paper)
43% identity, 88% coverage: 28:274/280 of query aligns to 7:252/257 of 6y4dA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G39), T20 (≠ S41), K21 (= K42), I23 (= I44), R43 (= R64), C67 (≠ A90), D68 (= D91), I69 (≠ L92), N96 (= N118), G98 (= G120), V146 (= V168), S147 (≠ G169), S148 (= S170), Y161 (= Y183), K165 (= K187), G192 (≠ W214), I194 (= I216), T196 (= T218), S198 (≠ R220)
1ae1B Tropinone reductase-i complex with NADP (see paper)
40% identity, 90% coverage: 28:280/280 of query aligns to 2:258/258 of 1ae1B
- active site: G17 (= G43), S143 (= S170), V153 (≠ G180), Y156 (= Y183), K160 (= K187)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G39), S15 (= S41), K16 (= K42), G17 (= G43), I18 (= I44), S37 (≠ A63), R38 (= R64), C62 (≠ A90), D63 (= D91), L64 (= L92), N91 (= N118), A92 (= A119), S143 (= S170), Y156 (= Y183), K160 (= K187), P186 (= P213), I189 (= I216), T191 (= T218), L193 (≠ R220), V194 (≠ S221)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
34% identity, 89% coverage: 28:275/280 of query aligns to 2:249/252 of 1vl8B
- active site: G17 (= G43), S143 (= S170), I154 (≠ T179), Y157 (= Y183), K161 (= K187)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G39), R16 (≠ K42), G17 (= G43), L18 (≠ I44), S37 (≠ A63), R38 (= R64), C63 (≠ A90), D64 (= D91), V65 (≠ L92), A91 (≠ N118), A92 (= A119), G93 (= G120), I94 (≠ G121), V114 (≠ L141), I141 (≠ V168), S143 (= S170), Y157 (= Y183), K161 (= K187), P187 (= P213), G188 (≠ W214), Y190 (≠ I216), T192 (= T218), M194 (≠ R220), T195 (≠ S221)
3lqfA Crystal structure of the short-chain dehydrogenase galactitol- dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD and erythritol (see paper)
39% identity, 89% coverage: 28:275/280 of query aligns to 7:251/254 of 3lqfA
- active site: G22 (= G43), S144 (= S170), Y159 (= Y183), K163 (= K187)
- binding meso-erythritol: N151 (≠ T175), Y159 (= Y183), Y191 (= Y215), T197 (≠ S221), M200 (≠ A224)
- binding nicotinamide-adenine-dinucleotide: G18 (= G39), S21 (≠ K42), G22 (= G43), I23 (= I44), D42 (≠ A63), R43 (= R64), D66 (≠ F88), V67 (≠ A89), S92 (≠ N118), L142 (≠ V168), S144 (= S170), K163 (= K187), P189 (= P213), V192 (≠ I216), T194 (= T218), M196 (≠ R220), T197 (≠ S221)
2wsbA Crystal structure of the short-chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD (see paper)
39% identity, 89% coverage: 28:275/280 of query aligns to 7:251/254 of 2wsbA
- active site: G22 (= G43), S144 (= S170), Y159 (= Y183), K163 (= K187)
- binding nicotinamide-adenine-dinucleotide: G18 (= G39), S21 (≠ K42), G22 (= G43), I23 (= I44), D42 (≠ A63), R43 (= R64), D66 (≠ F88), V67 (≠ A89), S92 (≠ N118), A93 (= A119), L142 (≠ V168), S144 (= S170), Y159 (= Y183), K163 (= K187), P189 (= P213), V192 (≠ I216), T194 (= T218), M196 (≠ R220), T197 (≠ S221)
- binding n-propanol: S144 (= S170), M145 (≠ V171), N151 (≠ T175), N151 (≠ T175), Y159 (= Y183), Y159 (= Y183), Y191 (= Y215)
2wdzA Crystal structure of the short chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD+ and 1,2-pentandiol (see paper)
39% identity, 89% coverage: 28:275/280 of query aligns to 7:251/254 of 2wdzA
- active site: G22 (= G43), S144 (= S170), Y159 (= Y183), K163 (= K187)
- binding (2S)-pentane-1,2-diol: A45 (≠ D66), D49 (≠ E70), R62 (≠ E84), S146 (= S172), Y159 (= Y183)
- binding nicotinamide-adenine-dinucleotide: G18 (= G39), S21 (≠ K42), G22 (= G43), I23 (= I44), D42 (≠ A63), R43 (= R64), A65 (= A87), D66 (≠ F88), V67 (≠ A89), S92 (≠ N118), A93 (= A119), L142 (≠ V168), S144 (= S170), Y159 (= Y183), K163 (= K187), P189 (= P213), V192 (≠ I216), T194 (= T218), M196 (≠ R220), T197 (≠ S221)
C0KTJ6 Galactitol 2-dehydrogenase (L-tagatose-forming); Galactitol dehydrogenase; GDH; GatDH; Galactitol:NAD(+) 5-oxidoreductase; EC 1.1.1.406 from Cereibacter sphaeroides (Rhodobacter sphaeroides) (see paper)
39% identity, 89% coverage: 28:275/280 of query aligns to 7:251/254 of C0KTJ6
Sites not aligning to the query:
1yxmB Crystal structure of peroxisomal trans 2-enoyl coa reductase
32% identity, 88% coverage: 30:274/280 of query aligns to 9:249/283 of 1yxmB
- active site: G22 (= G43), V152 (≠ T175), G157 (= G180), H163 (vs. gap), S164 (vs. gap), R168 (≠ K187)
- binding adenine: S42 (≠ A63), R43 (= R64), C72 (≠ A90), N73 (≠ D91), I74 (≠ L92), T123 (≠ L141)
Q9BY49 Peroxisomal trans-2-enoyl-CoA reductase; TERP; 2,4-dienoyl-CoA reductase-related protein; DCR-RP; HPDHase; Short chain dehydrogenase/reductase family 29C member 1; pVI-ARL; EC 1.3.1.38 from Homo sapiens (Human) (see paper)
32% identity, 88% coverage: 30:274/280 of query aligns to 16:264/303 of Q9BY49
Sites not aligning to the query:
- 303 mutation Missing: Abolishes localization to peroxisomes.
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
34% identity, 89% coverage: 28:275/280 of query aligns to 4:244/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G39), S17 (= S41), R18 (≠ K42), I20 (= I44), T40 (≠ R64), N62 (≠ D91), V63 (≠ L92), N89 (= N118), A90 (= A119), I92 (≠ G121), V139 (= V168), S141 (= S170), Y154 (= Y183), K158 (= K187), P184 (= P213), G185 (≠ W214), I187 (= I216), T189 (= T218), M191 (≠ R220)
Query Sequence
>N515DRAFT_2198 FitnessBrowser__Dyella79:N515DRAFT_2198
MGEAATSGWPGRDAGSKLAGMNNRIDAWQLQGHTALITGASKGIGYAVARELAGLGANLL
LVARDDDHLEQVRVELADDFDHIEVLAFAADLSMQEDRLAVFDWIADLGAPLSLLVNNAG
GNTPAAVLEYSERDYRAIFELNLFSAFEMCRLAHPQLVQHANAAIVNVGSVSGITHVRTG
AAYGMSKAALHQLTRNLAAEWATDGIRVNAVAPWYIRTQRSEPALADDEYLDEVLDHTPL
RRIGEPEEVAAAIAFLCLPAASYITGQVLAVDGGFLNYGF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory