Comparing N515DRAFT_2216 FitnessBrowser__Dyella79:N515DRAFT_2216 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8i6rB Cryo-em structure of pseudomonas aeruginosa ftse(e163q)x/envc complex with atp in peptidisc (see paper)
59% identity, 97% coverage: 1:218/225 of query aligns to 1:218/222 of 8i6rB
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
56% identity, 99% coverage: 1:222/225 of query aligns to 1:222/222 of P0A9R7
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
58% identity, 96% coverage: 1:215/225 of query aligns to 1:215/219 of 8w6iD
8hd0A Cell divisome spg hydrolysis machinery ftsex-envc
57% identity, 96% coverage: 1:215/225 of query aligns to 1:215/218 of 8hd0A
8tzjA Cryo-em structure of vibrio cholerae ftse/ftsx complex (see paper)
56% identity, 96% coverage: 1:215/225 of query aligns to 2:217/220 of 8tzjA
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
44% identity, 97% coverage: 1:218/225 of query aligns to 3:220/230 of 6z4wA
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
44% identity, 97% coverage: 1:218/225 of query aligns to 3:220/229 of 6z67B
8iddA Cryo-em structure of mycobacterium tuberculosis atp bound ftsex/ripc complex in peptidisc (see paper)
45% identity, 97% coverage: 1:218/225 of query aligns to 2:220/225 of 8iddA
8igqA Cryo-em structure of mycobacterium tuberculosis adp bound ftsex/ripc complex in peptidisc (see paper)
45% identity, 97% coverage: 1:218/225 of query aligns to 2:220/227 of 8igqA
A5U7B7 Cell division ATP-binding protein FtsE from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) (see 2 papers)
45% identity, 97% coverage: 1:218/225 of query aligns to 1:219/229 of A5U7B7
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
43% identity, 98% coverage: 1:220/225 of query aligns to 5:228/233 of P75957
7mdyC Lolcde nucleotide-bound
43% identity, 98% coverage: 1:220/225 of query aligns to 2:225/226 of 7mdyC
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
42% identity, 98% coverage: 1:220/225 of query aligns to 4:227/229 of 7v8iD
7arlD Lolcde in complex with lipoprotein and adp (see paper)
43% identity, 96% coverage: 1:217/225 of query aligns to 2:222/222 of 7arlD
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
39% identity, 100% coverage: 1:225/225 of query aligns to 1:229/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
38% identity, 100% coverage: 1:225/225 of query aligns to 2:230/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
38% identity, 100% coverage: 1:225/225 of query aligns to 2:230/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
38% identity, 100% coverage: 1:225/225 of query aligns to 2:230/344 of 3tuiC
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
36% identity, 98% coverage: 1:220/225 of query aligns to 3:225/226 of 5xu1B
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
37% identity, 92% coverage: 12:218/225 of query aligns to 18:224/650 of 5ws4A
>N515DRAFT_2216 FitnessBrowser__Dyella79:N515DRAFT_2216
MIRFDQVSKRYEGGHEALSQLSFQVAPGEMAFVTGHSGAGKSTLLKLLGLIERPSHGSIS
LDGQSLAKIGRGGIPKLRRRIGMVFQDHRLLMDRTVFANVELPLVIGGVAPAERGRRVRA
ALEKVGLLAYERQLPATLSTGEQQRVGIARAIVAKPTLLIADEPTGNLDPQLAVEIMGLF
AEFQQVGTTVLVASHDLPLIKRMRKRVVVLDHGRLVADIAAEEVL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory