Comparing N515DRAFT_2222 FitnessBrowser__Dyella79:N515DRAFT_2222 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
4v15A Crystal structure of d-threonine aldolase from alcaligenes xylosoxidans (see paper)
27% identity, 86% coverage: 49:414/426 of query aligns to 21:357/373 of 4v15A
A1B8Z1 3-hydroxy-D-aspartate aldolase; beta-hydroxyaspartate aldolase; EC 4.1.3.41 from Paracoccus denitrificans (strain Pd 1222) (see paper)
22% identity, 71% coverage: 43:346/426 of query aligns to 24:316/387 of A1B8Z1
Sites not aligning to the query:
6qkbA Crystal structure of the beta-hydroxyaspartate aldolase of paracoccus denitrificans (see paper)
22% identity, 71% coverage: 43:346/426 of query aligns to 21:313/384 of 6qkbA
Sites not aligning to the query:
7yqaB Crystal structure of d-threonine aldolase from chlamydomonas reinhardtii (see paper)
27% identity, 43% coverage: 44:228/426 of query aligns to 19:203/398 of 7yqaB
Sites not aligning to the query:
3wqeA D-threo-3-hydroxyaspartate dehydratase from delftia sp. Ht23 complexed with d-allothreonine (see paper)
33% identity, 33% coverage: 46:184/426 of query aligns to 7:143/379 of 3wqeA
Sites not aligning to the query:
3wqdA D-threo-3-hydroxyaspartate dehydratase from delftia sp. Ht23 complexed with d-erythro-3-hydroxyaspartate (see paper)
33% identity, 33% coverage: 46:184/426 of query aligns to 7:143/379 of 3wqdA
Sites not aligning to the query:
3wqcA D-threo-3-hydroxyaspartate dehydratase from delftia sp. Ht23 (see paper)
33% identity, 33% coverage: 46:184/426 of query aligns to 7:143/379 of 3wqcA
Sites not aligning to the query:
B2DFG5 D-threo-3-hydroxyaspartate dehydratase; D-THA DH; D-THA dehydratase; Threo-3-hydroxy-D-aspartate ammonia-lyase; EC 4.3.1.27 from Delftia sp. (strain HT23) (see paper)
33% identity, 33% coverage: 46:184/426 of query aligns to 8:144/380 of B2DFG5
4pb3B D-threo-3-hydroxyaspartate dehydratase h351a mutant (see paper)
33% identity, 33% coverage: 46:184/426 of query aligns to 17:153/389 of 4pb3B
Sites not aligning to the query:
4pb5A D-threo-3-hydroxyaspartate dehydratase h351a mutant complexed with l- erythro-3-hydroxyaspartate (see paper)
33% identity, 33% coverage: 46:184/426 of query aligns to 7:143/379 of 4pb5A
Sites not aligning to the query:
4pb4A D-threo-3-hydroxyaspartate dehydratase h351a mutant complexed with 2- amino maleic acid (see paper)
33% identity, 33% coverage: 46:184/426 of query aligns to 7:143/379 of 4pb4A
Sites not aligning to the query:
>N515DRAFT_2222 FitnessBrowser__Dyella79:N515DRAFT_2222
MSDNASRSEQLAPFVHPLDKGIGALDAPCAPEAIASHGWNLLKEDLSLPVAVLSQSRLEH
NLAWMQRFASEYGARLAPHGKTTMAPRLFARQLEAGAWGITLATAQQARAAYVHGVRRIL
LANQLVGRRNMAIVAELLADPSFEFFCLVDAAEQVRQLAAFFGAAGRRIQVLIELGVPGG
RTGVRDEAQWQAVLDALAQSGGAVSLAGVEVYEGVLKDETAIRAFLQRGVEAVQVLARDG
RLQRTPAVLSGAGSAWYDVVAEEFAKAQIGAPLDVVLRPGCYLTHDVGAYRIAQARIDAS
NPQARRMRSSLLPALQVWAYVQSVPEPECAIVAMGKRDAAFDAGFPSPAAHFRPGGSAPS
PVPPHWEVTGMMDQHAYLKIAAGDDLRVGDMLAFDISHPCLTFDKWRQLPVIDDAYDVVD
VVQTYF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory